7DS3: Actin capping protein

Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail. Determined by X-ray diffraction at 2.09 Å resolution. Released 3 Mar 2021.

Method: X-ray diffraction
Resolution: 2.09 Å
Organisms: Gallus gallus, Mus musculus
Chains: 3
Atoms: 4,398
Mol. weight: 63.77 kDa
Released: 3 Mar 2021

Explore 7DS3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7DS3 contains 22 α-helices and 21 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	10-22	13
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-49	7
α-helix	51-61	11
β-strand	64-65	2	1
α-helix	66-67	2
β-strand	74-75	2	1
α-helix	78-80	3
β-strand	81-83	3	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	118-135	18
β-strand	140-148	9	3
β-strand	151-164	14	3
β-strand	169-182	14	3
β-strand	185-198	14	3
β-strand	203-217	15	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	255-258	4
α-helix	271-275	5

Chain B: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
β-strand	48-52	5	4
β-strand	57-61	5	4
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-137	11	3
β-strand	145-157	13	3
β-strand	165-181	17	3
β-strand	185-201	17	3
α-helix	209-227	19
α-helix	228-233	6
α-helix	234-243	10

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	323-327	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1	B	protein	244	Gallus gallus	P14315 (AlphaFold model)
Twinfilin-2	C	protein	30	Mus musculus	Q9Z0P5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7DS3_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>7DS3_2 F-actin-capping protein subunit beta isoforms 1 (chains B)
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGLR

Sequence of entity 3 (C), FASTA

>7DS3_3 Twinfilin-2 (chains C)
KQHAFKQAFAKPKGPGGKRGHKRLIRGPGE

Primary citation

Structural Insights into the Regulation of Actin Capping Protein by Twinfilin C-terminal Tail. Takeda, S., Koike, R., Fujiwara, I. et al. J Mol Biol (2021) 433:166891-166891. DOI 10.1016/j.jmb.2021.166891 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
9BLI 2.0 Å, Crystal structure of Actin capping protein in complex with a fragment of Legionella…
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ
3AAA 2.2 Å, Crystal Structure of Actin capping protein in complex with V-1

Browse structure collections

About this viewer

MolViewer shows 7DS3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.