9BLI: Actin capping protein

Crystal structure of Actin capping protein in complex with a fragment of Legionella pneumophila RavB. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 May 2025.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Gallus gallus, Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Chains: 3
Atoms: 4,594
Mol. weight: 65.96 kDa
Released: 7 May 2025

Explore 9BLI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9BLI contains 27 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	4-22	19
α-helix	24-25	2
α-helix	29-40	12
α-helix	43-49	7
α-helix	51-60	10
β-strand	64-65	2	1
α-helix	66-67	2
β-strand	74-75	2	1
α-helix	78-80	3
β-strand	81	1	2
β-strand	86-89	4	2
β-strand	94-99	6	2
β-strand	104-110	7	2
α-helix	115-135	21
β-strand	140-147	8	3
β-strand	152-164	13	3
α-helix	165-167	3
β-strand	169-180	12	3
β-strand	185-198	14	3
β-strand	202-217	16	3
α-helix	221-249	29
α-helix	250-254	5
α-helix	255-257	3
α-helix	271-274	4

Chain B: 11 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	4-13	10
α-helix	18-20	3
α-helix	21-31	11
α-helix	33-35	3
α-helix	36-42	7
β-strand	48-52	5	4
β-strand	57-61	5	4
α-helix	63-65	3
β-strand	66-67	2	5
β-strand	70-72	3	5
β-strand	79-80	2	5
α-helix	91-112	22
β-strand	116-124	9	3
β-strand	127-137	11	3
β-strand	145-159	15	3
α-helix	160-162	3
β-strand	164-181	18	3
β-strand	185-202	18	3
β-strand	204	1	6
β-strand	207	1	6
α-helix	209-230	22
α-helix	231-235	5
α-helix	236-243	8

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	123-124	2
α-helix	129-132	4
α-helix	133-136	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-actin-capping protein subunit alpha-1	A	protein	286	Gallus gallus	P13127 (AlphaFold model)
F-actin-capping protein subunit beta isoforms 1 and 2	B	protein	248	Gallus gallus	P14315 (AlphaFold model)
Integrase	C	protein	42	Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)	Q5ZZI0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9BLI_1 F-actin-capping protein subunit alpha-1 (chains A)
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYDDQVLITEHGDLGNGRFLDPRNKISFKFDHLRKEASDPQPEDTESALKQW
RDACDSALRAYVKDHYPNGFCTVYGKSIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVAAVLKIQVHYYEDGNVQLVSHKDIQDSVQVSSDVQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA

Sequence of entity 2 (B), FASTA

>9BLI_2 F-actin-capping protein subunit beta isoforms 1 and 2 (chains B)
GSEFMSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVG
KDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGV
SSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLW
LQTNKTGSGTMNLGGSLTRQMEKDETVSDSSPHIANIGRLVEDMENKIRSTLNEIYFGKT
KDIVNGLR

Sequence of entity 3 (C), FASTA

>9BLI_3 Integrase (chains C)
SKREETKLTHFVRERAQGPRGRRLPAHLQAKIKRVSLDKPHS

Primary citation

Bacterial ubiquitin ligase engineered for small molecule and protein target identification. Ye, J.S., Majumdar, A., Park, B.C. et al. EMBO J (2026) 45:1024-1050. DOI 10.1038/s44318-025-00665-0 · PubMed

Other PDB entries of the same protein (UniProt P13127 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DS6 1.69 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3AA0 1.7 Å, Crystal structure of Actin Capping Protein in complex with the Cp-binding motif derived…
7DS4 1.85 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail…
3AA1 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA6 1.9 Å, Crystal structure of Actin capping protein in complex with the Cp-binding motif derived…
3AA7 1.9 Å, Crystal structure of Actin capping protein
7DS2 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1 C-terminus tail
7DS8 1.95 Å, Crystal structure of actin capping protein in complex with twinflin-1/CD2AP CPI chimera…
3LK4 1.99 Å, Crystal structure of CapZ bound to the uncapping motif from CD2AP
7DS3 2.09 Å, Crystal structure of actin capping protein in complex with twinflin-2 C-terminus tail
1IZN 2.1 Å, Crystal Structure of Actin Filament Capping Protein CapZ
3AAA 2.2 Å, Crystal Structure of Actin capping protein in complex with V-1

Browse structure collections

About this viewer

MolViewer shows 9BLI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.