7E0B: Sorting nexin 27 and PBM complex

The crystal structure of sorting nexin 27 and PBM complex. Determined by X-ray diffraction at 1.29 Å resolution. Released 2 Feb 2022.

Method: X-ray diffraction
Resolution: 1.29 Å
Organism: Homo sapiens
Chains: 2
Atoms: 917
Mol. weight: 11.04 kDa
Released: 2 Feb 2022

Explore 7E0B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7E0B contains 4 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	42-47	6	1
α-helix	48	1
β-strand	49	1	2
β-strand	52	1	2
β-strand	55-60	6	1
α-helix	65-67	3
β-strand	68-70	3	3
β-strand	73-75	3	3
β-strand	80-84	5	1
α-helix	89-93	5
β-strand	100-104	5	1
β-strand	107-108	2	1
α-helix	114-122	9
β-strand	127-133	7	1

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	202-206	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-27	A	protein	96	Homo sapiens	Q96L92 (AlphaFold model)
PBM	B	protein	7	Homo sapiens

Sequence of entity 1 (A), FASTA

>7E0B_1 Sorting nexin-27 (chains A)
GPRVVRIVKSESGYGFNVRGQVSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGD
RILEVNHVNVEGATHKQVVDLIRAGEKELILTVLSV

Sequence of entity 2 (B), FASTA

>7E0B_2 PBM (chains B)
DDVQTSF

Primary citation

SNX27 suppresses SARS-CoV-2 infection by inhibiting viral lysosome/late endosome entry. Yang, B., Jia, Y., Meng, Y. et al. Proc Natl Acad Sci U S A (2022) 119. DOI 10.1073/pnas.2117576119 · PubMed

Other PDB entries of the same protein (UniProt Q96L92 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HAS 1.74 Å, Crystal structure of PX domain of human sorting nexin SNX27
5ZN9 1.78 Å, Crystal structure of PX domain
7CT1 1.95 Å, Crystal structure of Snx27 FERM domain in complex with a DLF motif
6SAK 2.0 Å, Structure of the OTULINcat C129A - SNX27 PDZ domain complex.
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
8TTV 2.0 Å, Structure of SNX27 FERM complexed with Fam21A repeat 20 (1289-1302)
7P72 2.15 Å, The PDZ domain of SNX27 complexed with the PDZ-binding motif of MERS-E
8TTT 2.35 Å, Structure of SNX27 FERM complexed with Fam21A repeat 15 (1124-1140)
8TTU 2.36 Å, Structure of SNX27 FERM complexed with Fam21A repeat 19 (1261 - 1274)

Browse structure collections

About this viewer

MolViewer shows 7E0B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.