7EA2: NAP1 FIR

crystal structure of NAP1 FIR in complex with RB1CC1 Claw domain. Determined by X-ray diffraction at 2.14 Å resolution. Released 22 Dec 2021.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,905
Mol. weight: 28.56 kDa
Ligands: FLC
Released: 22 Dec 2021

Explore 7EA2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EA2 contains 5 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1478-1485	8	3
β-strand	1495-1497	3	2
β-strand	1506-1512	7	1
β-strand	1517-1520	4	1
β-strand	1528-1530	3	1
α-helix	1531	1
α-helix	1532-1538	7
β-strand	1554-1567	14	1
β-strand	1581-1588	8	1

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1478-1485	8	1
β-strand	1495-1497	3	2
β-strand	1506-1512	7	3
α-helix	1513-1515	3
β-strand	1517-1520	4	3
β-strand	1528-1530	3	3
α-helix	1531	1
α-helix	1532-1534	3
β-strand	1554-1567	14	3
β-strand	1581-1589	9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-azacytidine-induced protein 2,RB1-inducible coiled-coil protein 1	A, B	protein	124	Homo sapiens	Q8TDY2 (AlphaFold model), Q9H6S1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7EA2_1 5-azacytidine-induced protein 2,RB1-inducible coiled-coil protein 1 (chains A, B)
GPGSEDDICILNHEKGSGSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFL
HSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSW
NKKV

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	1

Water and common crystallization additives (P6G, PEG) are not listed.

Primary citation

Structural and biochemical advances on the recruitment of the autophagy-initiating ULK and TBK1 complexes by autophagy receptor NDP52. Fu, T., Zhang, M., Zhou, Z. et al. Sci Adv (2021) 7. DOI 10.1126/sciadv.abi6582 · PubMed

Other PDB entries of the same protein (UniProt Q8TDY2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7D0E 1.4 Å, Crystal structure of FIP200 Claw/p-CCPG1 FIR2
9D34 1.42 Å, FIP200 C-terminal CLAW domain (resid. 1490-1594) in complex with phosphorylated TNIP1…
8YFL 1.5 Å, crystal structure of FIP200 claw/TNIP1_FIR_pS122pS123
8YFM 1.5 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS122
6DCE 1.56 Å, X-ray structure of FIP200 claw domain
9J54 1.61 Å, Crystal structure of FIP200 Claw in complex with ATG16L1
7CZG 1.8 Å, Crystal structure of FIP200 Claw domain apo form
9LUA 1.97 Å, Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
8YFK 2.0 Å, Crystal structure of FIP200 claw/TNIP1_FIR_pS123
8YFN 2.3 Å, Crystal structure of FIP200 claw in complex with TNIP1_FIR_pS123 peptide with an…
8W6B 2.39 Å, crystal structure of TAX1BP1 SKICH domain in complex with RB1CC1 coiled-coil domain

Browse structure collections

About this viewer

MolViewer shows 7EA2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.