7EJ9: Cryptochrome-2

Alternative crystal structure of mouse Cryptochrome 2 in complex with TH301 compound. Determined by X-ray diffraction at 2.6 Å resolution. Released 23 Jun 2021.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,391
Mol. weight: 118.67 kDa
Ligands: DYX
Released: 23 Jun 2021

Explore 7EJ9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EJ9 contains 68 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
α-helix	37-43	7
β-strand	48-55	8	1
α-helix	59-61	3
α-helix	67-85	19
β-strand	91-95	5	1
α-helix	98-108	11
β-strand	113-117	5	1
α-helix	122-138	17
β-strand	141-145	5	1
α-helix	153-159	7
α-helix	168-176	9
α-helix	179-189	11
α-helix	190-195	6
α-helix	197-199	3
α-helix	204-208	5
α-helix	210-212	3
α-helix	223-226	4
α-helix	232-242	11
α-helix	245-248	4
α-helix	249-253	5
α-helix	259-262	4
α-helix	264-265	2
α-helix	270-275	6
α-helix	280-294	15
α-helix	302-305	4
α-helix	306-318	13
α-helix	334-335	2
β-strand	339	1	2
α-helix	342-349	8
α-helix	356-368	13
α-helix	373-383	11
β-strand	390	1	2
α-helix	392-402	11
α-helix	408-419	12
α-helix	430-432	3
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-454	3
α-helix	459-462	4
α-helix	465-467	3
α-helix	470-475	6
β-strand	480	1	3
β-strand	484	1	3
α-helix	485-487	3
α-helix	491-505	15

Chain B: 31 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	4
α-helix	37-43	7
β-strand	48-55	8	4
α-helix	59-61	3
α-helix	63-64	2
α-helix	67-85	19
β-strand	91-95	5	4
α-helix	98-108	11
β-strand	113-117	5	4
α-helix	122-137	16
β-strand	141-145	5	4
α-helix	153-159	7
α-helix	168-176	9
α-helix	179-189	11
α-helix	190-195	6
α-helix	197-199	3
α-helix	204-208	5
α-helix	232-247	16
α-helix	264-265	2
α-helix	270-275	6
α-helix	280-294	15
α-helix	302-305	4
α-helix	306-318	13
α-helix	334-335	2
α-helix	342-350	9
α-helix	356-368	13
α-helix	373-383	11
α-helix	392-402	11
α-helix	408-418	11
α-helix	435-440	6
α-helix	445-450	6
α-helix	452-456	5
α-helix	465-467	3
α-helix	470-475	6
β-strand	480	1	5
β-strand	484	1	5
α-helix	485-487	3
α-helix	491-505	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cryptochrome-2	A, B	protein	514	Mus musculus	Q9R194 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7EJ9_1 Cryptochrome-2 (chains A, B)
GTMAAAAVVAATVPAQSMGADGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPW
FAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEY
DSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRM
ELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALAR
LDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNS
TPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWI
DAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWL
SCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKC
IIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY

Ligands and cofactors

ID	Name	Formula	Copies
DYX	1-(4-chlorophenyl)-N-[2-(4-methoxyphenyl)-5,5-bis(oxidanylidene)-4,6-dihydrothi…	C24 H24 Cl N3 O4 S	2

Primary citation

Structural differences in the FAD-binding pockets and lid loops of mammalian CRY1 and CRY2 for isoform-selective regulation. Miller, S., Srivastava, A., Nagai, Y. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2026191118 · PubMed

Other PDB entries of the same protein (UniProt Q9R194 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V8Y 1.9 Å, Crystal structure of mouse CRY2 in complex with SHP1703 compound
4MLP 1.94 Å, Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
7V8Z 1.95 Å, Crystal structure of mouse CRY2 in complex with SHP656 compound
4I6G 2.2 Å, a vertebrate cryptochrome with FAD
6KX8 2.25 Å, Crystal structure of mouse Cryptochrome 2 in complex with TH301 compound
4I6E 2.7 Å, A vertebrate cryptochrome
4I6J 2.7 Å, A ubiquitin ligase-substrate complex
4U8H 2.8 Å, Crystal Structure of Mammalian Period-Cryptochrome Complex
7D0N 2.8 Å, Crystal structure of mouse CRY2 apo form

Browse structure collections

About this viewer

MolViewer shows 7EJ9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.