7ELG: LC3B modificated with a covalent probe

LC3B modificated with a covalent probe. Determined by X-ray diffraction at 1.6 Å resolution. Released 13 Oct 2021.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,111
Mol. weight: 14.78 kDa
Ligands: 8Z6
Released: 13 Oct 2021

Explore 7ELG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ELG contains 6 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	11-14	4
α-helix	17-30	14
β-strand	34-41	8	1
α-helix	49-51	3
β-strand	55-59	5	1
β-strand	63	1	2
α-helix	64-74	11
β-strand	84-87	4	1
β-strand	90-91	2	1
β-strand	98	1	2
α-helix	99-106	8
β-strand	113-118	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated proteins 1A/1B light chain 3B	A	protein	123	Homo sapiens	Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ELG_1 Microtubule-associated proteins 1A/1B light chain 3B (chains A)
GSPEFPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPD
HVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQ
ETF

Ligands and cofactors

ID	Name	Formula	Copies
8Z6	2-methylidene-5-thiophen-2-yl-cyclohexane-1,3-dione	C11 H10 O2 S	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Inhibition of Autophagy by a Small Molecule through Covalent Modification of the LC3 Protein. Fan, S., Yue, L., Wan, W. et al. Angew Chem Int Ed Engl (2021) 60:26105-26114. DOI 10.1002/anie.202109464 · PubMed

Other PDB entries of the same protein (UniProt Q9GZQ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q53 1.36 Å, Crystal structure of truncated human Microtubule-associated proteins 1A/1B light chain…
6LAN 1.41 Å, Structure of CCDC50 and LC3B complex
5D94 1.53 Å, Crystal structure of LC3-LIR peptide complex
5MS5 1.53 Å, Low-salt structure of RavZ LIR2-fused human LC3B
2ZJD 1.56 Å, Crystal Structure of LC3-p62 complex
7GAG 1.59 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAU 1.59 Å, PanDDA analysis group deposition of ground-state model of MAP1LC3B
3VTU 1.6 Å, Crystal structure of human LC3B_2-119
8Q7K 1.6 Å, IRGQ LIR2 peptide in complex with LC3B
7GAP 1.68 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
7GAO 1.69 Å, PanDDA analysis group deposition -- Crystal Structure of MAP1LC3B in complex with…
3VTV 1.7 Å, Crystal structure of Optineurin LIR-fused human LC3B_2-119

Browse structure collections

About this viewer

MolViewer shows 7ELG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.