3VTV: Optineurin LIR-fused human LC3B_2-119

Crystal structure of Optineurin LIR-fused human LC3B_2-119. Determined by X-ray diffraction at 1.7 Å resolution. Released 26 Jun 2013.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,151
Mol. weight: 15.75 kDa
Released: 26 Jun 2013

Explore 3VTV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

3VTV contains 7 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	17-21	5
α-helix	22-25	4
α-helix	28-41	14
β-strand	45-52	8	1
α-helix	60-62	3
β-strand	66-70	5	1
β-strand	74	1	2
α-helix	75-85	11
β-strand	95-98	4	1
β-strand	101-102	2	1
β-strand	109	1	2
α-helix	110-117	8
α-helix	123	1
β-strand	124-129	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Optineurin, microtubule-associated proteins 1A/1B light chain 3B	A	protein	134	Homo sapiens	Q96CV9 (AlphaFold model), Q9GZQ8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>3VTV_1 Optineurin, microtubule-associated proteins 1A/1B light chain 3B (chains A)
GSEEGEEEDEFVEIGGPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLP
VLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDE
DGFLYMVYASQETF

Primary citation

Structural basis for phosphorylation-triggered autophagic clearance of Salmonella. Rogov, V.V., Suzuki, H., Fiskin, E. et al. Biochem J (2013) 454:459-466. DOI 10.1042/BJ20121907 · PubMed

Other PDB entries of the same protein (UniProt Q96CV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9B0B 1.7 Å, Structure of Optineurin bound to HOIP NZF1 domain
9B12 1.81 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
9M0O 1.83 Å, Crystal structure of OPTN 138-170 in complex with GTP-bound RAB8A1-176 (Q67L)
9IKQ 1.93 Å, Crystal structure of OPTN LZD in complex with GTP-bound Rab8a(Q67L)
7CZM 2.0 Å, Crystal structure of FIP200 Claw/p-OPtineurin LIR complex
5EOF 2.05 Å, Crystal structure of OPTN NTD and TBK1 CTD complex
9B0Z 2.41 Å, Structure of Optineurin bound to HOIP NZF1 domain and M1-linked diubiquitin, crystal…
5EOA 2.5 Å, Crystal structure of OPTN E50K mutant and TBK1 complex
3VTW 2.52 Å, Crystal structure of T7-tagged Optineurin LIR-fused human LC3B_2-119
5B83 2.69 Å, Crystal structure of Optineurin UBAN in complex with linear ubiquitin
2LO4 NMR Solution Structure of Optineurin Zinc-finger Domain
2LUE LC3B OPTN-LIR Ptot complex structure

Browse structure collections

About this viewer

MolViewer shows 3VTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.