7F8U: Cholecystokinin receptor CCKAR

Crystal structure of the cholecystokinin receptor CCKAR in complex with lintitript. Determined by X-ray diffraction at 2.8 Å resolution. Released 13 Oct 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, Enterobacteria phage T4
Chains: 1
Atoms: 3,510
Mol. weight: 60.86 kDa
Ligands: 1OE
Released: 13 Oct 2021

Explore 7F8U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F8U contains 26 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	40-68	29
α-helix	75-93	19
α-helix	96-104	9
α-helix	111-144	34
α-helix	151-153	3
α-helix	155-172	18
α-helix	175-179	5
β-strand	180-186	7	1
α-helix	188-190	3
β-strand	192-198	7	1
α-helix	203-214	12
α-helix	215-219	5
α-helix	220-238	19
α-helix	1242-1250	9
β-strand	1253-1254	2	2
β-strand	1255	1	3
β-strand	1256-1258	3	2
β-strand	1264-1267	4	2
β-strand	1270-1273	4	2
α-helix	1278-1289	12
β-strand	1296	1	3
α-helix	1299-1319	21
α-helix	1324-1328	5
α-helix	1332-1345	14
α-helix	1347-1351	5
α-helix	1354-1361	8
α-helix	1365-1372	8
α-helix	1376-1380	5
α-helix	1382-1394	13
α-helix	304-338	35
α-helix	340-347	8
α-helix	350-361	12
α-helix	362-364	3
α-helix	365-372	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fusion protein of Cholecystokinin receptor type A and Endolysin	A	protein	534	Homo sapiens, Enterobacteria phage T4	P00720, P32238 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7F8U_1 Fusion protein of Cholecystokinin receptor type A and Endolysin (chains A)
DYKDDDDGAPDVVDSLLVNGSNITPPCELGLENETLFCLDQPRPSKEWQPAVQILLYSLI
FLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSNLMLCLFCMPFNLIPNLLKDFIFGS
AVCKTTTYFMGTSVSVSTWNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFT
IMTPYPIYSNLVPFTKNNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGL
ISLELYQGINIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGR
NTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVA
GFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYAANLMAKKRVI
RMLIVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCF
MNKRFRLGFMATFPCCPNPGPPGARGEVGEEEEGEFLEVLFQGPHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
1OE	2-[2-[[4-(2-chlorophenyl)-1,3-thiazol-2-yl]carbamoyl]indol-1-yl]ethanoic acid	C20 H14 Cl N3 O3 S	1

Primary citation

Structures of the human cholecystokinin receptors bound to agonists and antagonists. Zhang, X., He, C., Wang, M. et al. Nat Chem Biol (2021) 17:1230-1237. DOI 10.1038/s41589-021-00866-8 · PubMed

Other PDB entries of the same protein (UniProt P00720), best resolution first:

2O7A 0.84 Å, T4 lysozyme C-terminal fragment
5JDT 1.0 Å, Structure of Spin-labelled T4 lysozyme mutant L118C-R1 at 100K
7LOE 1.01 Å, T4 lysozyme mutant L99A in complex with 1-fluoranylnaphthalene
7LOD 1.02 Å, T4 lysozyme mutant L99A in complex with 1-fluoranyl-4-iodanyl-benzene
7LX8 1.03 Å, T4 lysozyme mutant L99A
5XPF 1.04 Å, High-resolution X-ray structure of the T26H mutant of T4 lysozyme
6BG3 1.05 Å, Structure of (3S,4S)-1-benzyl-4-(3-(3-(trifluoromethyl)phenyl)ureido)piperidin-3-yl…
7LOF 1.05 Å, T4 lysozyme mutant L99A in complex with 2-butylthiophene
7LX6 1.05 Å, T4 lysozyme mutant L99A
7LX7 1.05 Å, T4 lysozyme mutant L99A
1SWY 1.06 Å, Use of a Halide Binding Site to Bypass the 1000-atom Limit to Ab initio Structure…
1SWZ 1.06 Å, Use of an ion-binding site to bypass the 1000-atom limit to ab initio structure…

Browse structure collections

About this viewer

MolViewer shows 7F8U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.