7F9W: CD25

CD25 in complex with Fab. Determined by electron microscopy at 3.2 Å resolution. Released 12 Jan 2022.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,217
Mol. weight: 92.18 kDa
Released: 12 Jan 2022

Explore 7F9W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7F9W contains 18 α-helices and 63 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
β-strand	13-16	4	1
β-strand	20-21	2	2
β-strand	25	1	3
β-strand	45-48	4	4
β-strand	53-56	4	4
β-strand	103-104	2	2
α-helix	106-109	4
β-strand	120	1	3
α-helix	121-122	2
β-strand	126-131	6	1
α-helix	132	1
β-strand	136-137	2	5
β-strand	144-146	3	1
β-strand	147	1	6
β-strand	156	1	6
α-helix	157-159	3
β-strand	163-164	2	5

Chain B: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	15
β-strand	10-12	3	16
β-strand	18-24	7	15
β-strand	32-39	8	16
β-strand	49-52	4	16
β-strand	57-60	4	16
β-strand	68-73	6	15
β-strand	78-83	6	15
β-strand	92-100	9	16
β-strand	111-112	2	16
β-strand	116-120	5	16
β-strand	126	1	17
β-strand	129-133	5	18
α-helix	134-136	3
β-strand	145-154	10	18
β-strand	155	1	17
β-strand	162-163	2	19
α-helix	164-166	3
β-strand	173-174	2	18
α-helix	175-177	3
β-strand	178-179	2	18
β-strand	185-193	9	18
α-helix	195-197	3
β-strand	204	1	20
β-strand	205-206	2	19
β-strand	207-209	3	21
α-helix	210-212	3
β-strand	214-216	3	21
β-strand	219	1	20

Chain C: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	7
β-strand	7	1	8
β-strand	10-13	4	9
β-strand	19-24	6	8
β-strand	25	1	7
β-strand	30-31	2	10
β-strand	36-37	2	10
β-strand	41-44	4	9
β-strand	51-55	5	9
β-strand	59-60	2	9
α-helix	61	1
β-strand	68-71	4	8
β-strand	76-81	6	8
α-helix	86-88	3
β-strand	90-93	4	9
β-strand	95	1	11
α-helix	102	1
β-strand	104	1	11
β-strand	108-112	5	9
β-strand	117	1	12
α-helix	118-119	2
β-strand	120-124	5	13
α-helix	125-127	3
α-helix	128-133	6
β-strand	135-143	9	13
β-strand	146	1	12
β-strand	151-156	6	14
β-strand	159-161	3	14
β-strand	165-169	5	13
α-helix	170-173	4
β-strand	180-188	9	13
α-helix	189-194	6
β-strand	197-203	7	14
β-strand	211-216	6	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-2 receptor subunit alpha	A	protein	161	Homo sapiens	P01589 (AlphaFold model)
Light chain of Fab	C	protein	220	Homo sapiens
Heavy chain of Fab	B	protein	452	Homo sapiens

Sequence of entity 1 (A), FASTA

>7F9W_1 Interleukin-2 receptor subunit alpha (chains A)
DDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSS
ATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVG
QMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTG

Sequence of entity 2 (C), FASTA

>7F9W_2 Light chain of Fab (chains C)
DIQMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKNYLAWYQQKPGQPPKLLIYWASTR
ESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQYYSTPYTFGQGTKVEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (B), FASTA

>7F9W_3 Heavy chain of Fab (chains B)
QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSDAINWVRQAPGQGLEWMGRIIPIFGVADY
AQKFQGRVTLTADKSTSTAYMDLSSLRSEDTAVFYCARERGDYSNFWYFDLWGRGTLVTV
SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELL
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ
YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSR
DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Primary citation

Two novel human anti-CD25 antibodies with antitumor activity inversely related to their affinity and in vitro activity. Song, D., Liu, X., Dong, C. et al. Sci Rep (2021) 11:22966-22966. DOI 10.1038/s41598-021-02449-y · PubMed

Other PDB entries of the same protein (UniProt P01589 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIO 1.83 Å, Crystal structure of FAB RG6292 in complex with CD25 ecd
2B5I 2.3 Å, cytokine receptor complex
1Z92 2.8 Å, structure of interleukin-2 with its alpha receptor
3NFP 2.86 Å, Crystal structure of the Fab fragment of therapeutic antibody daclizumab in complex with…
3IU3 2.9 Å, Crystal structure of the Fab fragment of therapeutic antibody Basiliximab in complex…
9KMC 2.97 Å, Cryo-EM structure of the heterotrimeric interleukin-2 receptor in complex with…
2ERJ 3.0 Å, Crystal structure of the heterotrimeric interleukin-2 receptor in complex with…
7ZMZ 3.2 Å, Engineered Interleukin 2 bound to CD25 receptor
6VWU 3.4 Å, X-ray structure of ALKS 4230, a fusion of circularly permuted human Interleukin-2 and…

Browse structure collections

About this viewer

MolViewer shows 7F9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.