7FCI: Human NTCP

human NTCP in complex with YN69083 Fab. Determined by electron microscopy at 3.3 Å resolution. Released 25 May 2022.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Mus musculus
Chains: 3
Atoms: 5,613
Mol. weight: 89.33 kDa
Released: 25 May 2022

Explore 7FCI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7FCI contains 27 α-helices and 50 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	21-42	22
α-helix	48-56	9
α-helix	59-70	12
α-helix	72-82	11
α-helix	87-97	11
β-strand	101	1	1
α-helix	104-111	8
α-helix	116-142	27
α-helix	156-179	24
α-helix	181-215	35
α-helix	220-243	24
α-helix	248-259	12
β-strand	261	1	1
α-helix	264-273	10
α-helix	276-279	4
α-helix	280-284	5
α-helix	285-309	25

Chain H: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	7
β-strand	9-12	4	3
β-strand	17-25	9	7
α-helix	29-31	3
β-strand	34-39	6	3
β-strand	41	1	8
β-strand	43	1	8
β-strand	45-51	7	3
β-strand	58-60	3	3
β-strand	70-73	4	7
β-strand	78-84	7	7
α-helix	88-90	3
β-strand	92-102	11	3
β-strand	107-112	6	3
β-strand	113	1	7
β-strand	116-120	5	3
β-strand	126	1	9
β-strand	129-133	5	10
α-helix	140-141	2
β-strand	144-147	4	11
β-strand	148-152	5	10
β-strand	155	1	9
β-strand	160-163	4	12
α-helix	164-166	3
β-strand	172-174	3	11
α-helix	175-177	3
β-strand	178-180	3	13
β-strand	183-185	3	13
β-strand	186	1	10
β-strand	188-193	6	11
α-helix	196-199	4
β-strand	203-208	6	12
β-strand	213-218	6	12

Chain L: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	2
β-strand	10-13	4	3
β-strand	19-24	6	2
β-strand	33-37	5	3
β-strand	44-48	5	3
β-strand	52-53	2	3
β-strand	61-66	6	2
β-strand	69-74	6	2
α-helix	79-81	3
β-strand	83-89	7	3
α-helix	95	1
β-strand	96-97	2	3
β-strand	101-105	5	3
β-strand	110	1	4
β-strand	115-117	3	5
α-helix	118-120	3
α-helix	121-126	6
β-strand	128-138	11	5
β-strand	139	1	4
β-strand	144-149	6	6
β-strand	152-153	2	6
β-strand	158-162	5	5
β-strand	172-181	10	5
α-helix	182-187	6
β-strand	190-196	7	6
α-helix	203	1
β-strand	204-209	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/bile acid cotransporter	A	protein	354	Homo sapiens	Q14973 (AlphaFold model)
Fab Light chain	L	protein	213	Mus musculus
Fab Heavy chain	H	protein	255	Mus musculus

Sequence of entity 1 (A), FASTA

>7FCI_1 Sodium/bile acid cotransporter (chains A)
GPGAPMEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHL
WKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGD
MNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIV
LKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFL
LGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLG
EGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA

Sequence of entity 2 (L), FASTA

>7FCI_2 Fab Light chain (chains L)
DIVMTQSPAIMSASPGQKVTITCSASSSVNYMHWYQQKLGSSPKLWIYDTSKLALGVPAR
FSGSGSGTSYSLTISSMEAEDAASYFCHQWSSYPRTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (H), FASTA

>7FCI_3 Fab Heavy chain (chains H)
EVQLQQPGAELVKPGASVKLSCKTSGYTFTNYWMKWVKQRPGQGLEWIGEINPSNGGTNY
NGKFKSKASLTVDKSSSTAYMQLSSLTSEDSAVYYCTILVYDAYYVFAMDYWGLGTSVTV
SSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQ
SDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVF
IFPPKPKDVLTITLT

Primary citation

Structural insights into the HBV receptor and bile acid transporter NTCP. Park, J.H., Iwamoto, M., Yun, J.H. et al. Nature (2022) 606:1027-1031. DOI 10.1038/s41586-022-04857-0 · PubMed

Other PDB entries of the same protein (UniProt Q14973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZYI 2.88 Å, Structure of the human sodium/bile acid cotransporter (NTCP) in complex with Fab and…
8HRX 2.89 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9048Fab complex
8HRY 3.11 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9016Fab complex
9QZQ 3.11 Å, CryoEM structure of nanodisc-reconstituted human NTCP in complex with grafted NTCP_Nb1…
7PQQ 3.3 Å, Structure of thermostabilised human NTCP in complex with Megabody 91
7VAG 3.32 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab in the presence of…
7WSI 3.32 Å, Cryo-EM structure of human NTCP (wild-type) complexed with YN69202Fab
7VAD 3.41 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab
8RQF 3.41 Å, Cryo-EM structure of human NTCP-Bulevirtide complex
7PQG 3.7 Å, Structure of thermostabilised human NTCP in complex with nanobody 87

Browse structure collections

About this viewer

MolViewer shows 7FCI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.