9QZQ: Nanodisc-reconstituted human NTCP

CryoEM structure of nanodisc-reconstituted human NTCP in complex with grafted NTCP_Nb1 and NabFab. Determined by electron microscopy at 3.11 Å resolution. Released 5 Nov 2025.

Method: Electron microscopy
Resolution: 3.11 Å
Organisms: Homo sapiens, Vicugna pacos
Chains: 4
Atoms: 6,479
Mol. weight: 102.37 kDa
Released: 5 Nov 2025

Explore 9QZQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QZQ contains 26 α-helices and 60 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	22-38	17
α-helix	59-69	11
α-helix	72-82	11
α-helix	87-96	10
α-helix	104-111	8
α-helix	116-142	27
α-helix	156-165	10
α-helix	167-179	13
α-helix	181-210	30
α-helix	213-216	4
α-helix	220-243	24
α-helix	248-259	12
α-helix	263-272	10
α-helix	276-279	4
α-helix	280-284	5
α-helix	285-309	25

Chain H: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	12	1	2
β-strand	17-25	9	1
β-strand	32-39	8	3
β-strand	45-51	7	3
β-strand	57-59	3	3
β-strand	67-72	6	1
β-strand	77-82A	7	1
β-strand	88-96	9	3
α-helix	99-102B	4
β-strand	105	1	3
β-strand	109-111	3	3
β-strand	113	1	2
β-strand	119	1	4
β-strand	122-126	5	5
α-helix	127-129	3
β-strand	138-147	10	5
β-strand	148	1	4
β-strand	153-156	4	6
β-strand	166-167	2	5
α-helix	168-170	3
β-strand	171-172	2	5
β-strand	178-186	9	5
α-helix	190-193	4
β-strand	196	1	7
β-strand	198-201	4	6
β-strand	202	1	8
β-strand	207	1	8
β-strand	213	1	7

Chain L: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	9
β-strand	10-13	4	10
β-strand	19-24	6	9
β-strand	34-38	5	10
β-strand	45-49	5	10
β-strand	53-54	2	10
α-helix	55	1
β-strand	62-67	6	9
β-strand	70-75	6	9
β-strand	85-91	7	10
β-strand	96-98	3	10
β-strand	102-106	5	10
β-strand	111	1	11
β-strand	114-118	5	12
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	12
β-strand	140	1	11
β-strand	144-150	7	13
β-strand	153-154	2	13
β-strand	159-163	5	12
α-helix	164-167	4
β-strand	173-182	10	12
α-helix	186-188	3
β-strand	191-198	8	13
β-strand	205-210	6	13

Chain N: 1 helix, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	14
β-strand	11-12	2	15
β-strand	18-24	7	14
β-strand	32-39	8	16
β-strand	46-51	6	16
β-strand	58-60	3	16
β-strand	68-73	6	14
β-strand	78-83	6	14
α-helix	85-87	3
β-strand	89-97	9	16
β-strand	103	1	17
β-strand	106	1	17
β-strand	113-114	2	16
β-strand	118-120	3	16
β-strand	121-122	2	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/bile acid cotransporter	A	protein	349	Homo sapiens	Q14973 (AlphaFold model)
NabFab - Heavy Chain	H	protein	239	Homo sapiens
NabFab - Light Chain	L	protein	215	Homo sapiens
Grafted Nanobody NTCP_Nb1	N	protein	137	Vicugna pacos

Sequence of entity 1 (A), FASTA

>9QZQ_1 Sodium/bile acid cotransporter (chains A)
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKG
LAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSI
VMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKR
PQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVL
SALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLL
IAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA

Sequence of entity 2 (H), FASTA

>9QZQ_2 NabFab - Heavy Chain (chains H)
EISEVQLVESGGGLVQPGGSLRLSCAASGFNFSYYSIHWVRQAPGKGLEWVAYISSSSSY
TSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARGYQYWQYHASWYWNGGLDY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSG
VHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 3 (L), FASTA

>9QZQ_3 NabFab - Light Chain (chains L)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQSSSSLITFGQGTKVEIKRTVAAPSVFIFP
PSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (N), FASTA

>9QZQ_4 Grafted Nanobody NTCP_Nb1 (chains N)
QRQLVESGGGLVQPGGSLRLSCAASRFTFDDYTIGWFRQAPGKEREGVSYMSSRDGSTYY
ADSVKGRFIISRDNVKNTVYLQMNSLEPEDTAVYYCAAAYRPWGLIGGNFDFSGAYWGKG
TPVTVSSHHHHHHEPEA

Primary citation

Structure of nanobody-inhibited state of human bile salt transporter NTCP. Yoon, D., Nosol, K., Rasouli, A. et al. Structure (2026) 34:113-122.e7. DOI 10.1016/j.str.2025.09.012 · PubMed

Other PDB entries of the same protein (UniProt Q14973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZYI 2.88 Å, Structure of the human sodium/bile acid cotransporter (NTCP) in complex with Fab and…
8HRX 2.89 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9048Fab complex
8HRY 3.11 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9016Fab complex
7FCI 3.3 Å, human NTCP in complex with YN69083 Fab
7PQQ 3.3 Å, Structure of thermostabilised human NTCP in complex with Megabody 91
7VAG 3.32 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab in the presence of…
7WSI 3.32 Å, Cryo-EM structure of human NTCP (wild-type) complexed with YN69202Fab
7VAD 3.41 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab
8RQF 3.41 Å, Cryo-EM structure of human NTCP-Bulevirtide complex
7PQG 3.7 Å, Structure of thermostabilised human NTCP in complex with nanobody 87

Browse structure collections

About this viewer

MolViewer shows 9QZQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.