7PQG: Thermostabilised human NTCP

Structure of thermostabilised human NTCP in complex with nanobody 87. Determined by electron microscopy at 3.7 Å resolution. Released 18 May 2022.

Method: Electron microscopy
Resolution: 3.7 Å
Organisms: Lama glama, Homo sapiens
Chains: 2
Atoms: 3,251
Mol. weight: 51.64 kDa
Released: 18 May 2022

Explore 7PQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PQG contains 22 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	21-43	23
α-helix	48-54	7
α-helix	59-82	24
α-helix	87-97	11
α-helix	103-112	10
α-helix	116-142	27
α-helix	149-152	4
α-helix	156-178	23
α-helix	181-183	3
α-helix	184-209	26
α-helix	212-217	6
α-helix	220-243	24
α-helix	248-259	12
α-helix	263-273	11
α-helix	276-279	4
α-helix	280-284	5
α-helix	285-309	25

Chain B: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	7	1	2
β-strand	18-23	6	2
β-strand	24-25	2	1
β-strand	33-36	4	3
β-strand	39	1	4
β-strand	49-52	4	3
β-strand	58-60	3	3
α-helix	62-64	3
β-strand	71-73	3	2
β-strand	78-83	6	2
α-helix	84-85	2
α-helix	88-90	3
β-strand	92-93	2	4
β-strand	96-99	4	3
α-helix	110-112	3
β-strand	115-116	2	3
α-helix	119-120	2
β-strand	121-122	2	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nanobody 87	B	protein	136	Lama glama
Sodium/bile acid cotransporter	A	protein	333	Homo sapiens	Q14973 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7PQG_1 Nanobody 87 (chains B)
QVQLVESGGGLVQAGGSLRLSCAVSGRTTANYNMGWFRQAPGKEREFVAGIKWSSGSTYV
ADSAKGRFTISRDNAKNSVYLQMDSLKPEDTALYYCAANYYGVSWFLISPSSYDYWGQGT
QVTVSSHHHHHHEPEA

Sequence of entity 2 (A), FASTA

>7PQG_2 Sodium/bile acid cotransporter (chains A)
MAHTASAPFTFTLPPNFGKRPTDLALSVILVVMLFIIMLSLGCTMEFSKIKAHLWKPKGL
AIALVAQYGIMPLTAFVLGKVFRLNNIEALAILICGCSPGGNLSNIFSLAMKGDMNLSIV
MTTCSTFLALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRP
QYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPHLIATSSLMPFIGFLLGYVLS
ALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLI
AIFWCYEKFKTPKDKTKMIYTAATTEELEVLFQ

Primary citation

Structural basis of sodium-dependent bile salt uptake into the liver. Goutam, K., Ielasi, F.S., Pardon, E. et al. Nature (2022) 606:1015-1020. DOI 10.1038/s41586-022-04723-z · PubMed

Other PDB entries of the same protein (UniProt Q14973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZYI 2.88 Å, Structure of the human sodium/bile acid cotransporter (NTCP) in complex with Fab and…
8HRX 2.89 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9048Fab complex
8HRY 3.11 Å, Cryo-EM structure of human NTCP-myr-preS1-YN9016Fab complex
9QZQ 3.11 Å, CryoEM structure of nanodisc-reconstituted human NTCP in complex with grafted NTCP_Nb1…
7FCI 3.3 Å, human NTCP in complex with YN69083 Fab
7PQQ 3.3 Å, Structure of thermostabilised human NTCP in complex with Megabody 91
7VAG 3.32 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab in the presence of…
7WSI 3.32 Å, Cryo-EM structure of human NTCP (wild-type) complexed with YN69202Fab
7VAD 3.41 Å, Cryo-EM structure of human NTCP complexed with YN69202Fab
8RQF 3.41 Å, Cryo-EM structure of human NTCP-Bulevirtide complex

Browse structure collections

About this viewer

MolViewer shows 7PQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.