THE 1.21 A CRYSTAL STRUCTURE OF HUMAN CATHEPSIN G IN COMPLEX WITH N-[2-[6-fluoro-2-[(4-hydroxy-5-methyl-2-oxo-5-phenylfuran-3-yl)-phenylmethyl]-1H-indol-3-yl]ethyl]acetamide. Determined by X-ray diffraction at 1.21 Å resolution. Released 5 Mar 2025.
Explore 7H6G in 3D Show helices and sheets RCSB PDB PDBe
7H6G contains 19 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-36A | 8 | 3 |
| β-strand | 38-48 | 11 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58 | 3 | |
| β-strand | 63-68 | 6 | 3 |
| β-strand | 72 | 1 | 4 |
| β-strand | 81-90 | 10 | 3 |
| β-strand | 104-108 | 5 | 3 |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| α-helix | 124-125 | 2 | |
| β-strand | 135-140 | 6 | 2 |
| β-strand | 145 | 1 | 6 |
| β-strand | 148 | 1 | 6 |
| β-strand | 154 | 1 | 4 |
| β-strand | 156-162 | 7 | 2 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-169 | 5 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-201 | 4 | 2 |
| β-strand | 204-215 | 8 | 2 |
| α-helix | 221 | 1 | |
| α-helix | 225 | 1 | |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-244 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 7 |
| β-strand | 20-21 | 2 | 8 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-36A | 8 | 9 |
| β-strand | 38-48 | 11 | 9 |
| β-strand | 51-54 | 4 | 9 |
| α-helix | 56-58 | 3 | |
| β-strand | 63-68 | 6 | 9 |
| β-strand | 72 | 1 | 10 |
| β-strand | 81-90 | 10 | 9 |
| β-strand | 95 | 1 | 11 |
| β-strand | 100 | 1 | 11 |
| β-strand | 104-108 | 5 | 9 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 12 |
| β-strand | 118 | 1 | 12 |
| β-strand | 122 | 1 | 8 |
| α-helix | 124-125 | 2 | |
| β-strand | 135-140 | 6 | 8 |
| β-strand | 154 | 1 | 10 |
| β-strand | 156-162 | 7 | 8 |
| α-helix | 163-164 | 2 | |
| α-helix | 165-171 | 7 | |
| β-strand | 180-183 | 4 | 8 |
| β-strand | 189 | 1 | 7 |
| β-strand | 198-201 | 4 | 8 |
| β-strand | 204-215 | 8 | 8 |
| α-helix | 221 | 1 | |
| α-helix | 225 | 1 | |
| β-strand | 226-230 | 5 | 8 |
| α-helix | 231-233 | 3 | |
| α-helix | 235-243 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cathepsin G | A, B | protein | 235 | Homo sapiens | P08311 (AlphaFold model) |
>7H6G_1 Cathepsin G (chains A, B) IIGGRESRPHSRPYMAYLQIQSPAGQSRCGGFLVREDFVLTAAHCWGSNINVTLGAHNIQ RRENTQQHITARRAIRHPQYNQRTIQNDIMLLQLSRRVRRNRNVNPVALPRAQEGLRPGT LCTVAGWGRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFKGD SGGPLLCNNVAHGIVSYGKSSGVPPEVFTRVSSFLPWIRTTMRSFKLLDQMETPL
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 4 |
| A1AOS | N-(2-{6-fluoro-2-[(R)-[(5R)-4-hydroxy-5-methyl-2-oxo-5-phenyl-2,5-dihydrofuran-… | C30 H27 F N2 O4 | 2 |
| BTB | 2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol | C8 H19 N O5 | 1 |
Water and common crystallization additives (SO4) are not listed.
The CASP 16 Experimental Protein-Ligand Datasets. Tosstorff, A., Rudolph, M.G., Benz, J. et al. Proteins (2026) 94:79-85. DOI 10.1002/prot.70053 · PubMed
Other PDB entries of the same protein (UniProt P08311 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7H6G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.