7JHX: HEPG5 LIR/GABARAPL1 complex

Crystal structure of hEPG5 LIR/GABARAPL1 complex. Determined by X-ray diffraction at 1.91 Å resolution. Released 17 Mar 2021.

Method: X-ray diffraction
Resolution: 1.91 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,353
Mol. weight: 32.11 kDa
Released: 17 Mar 2021

Explore 7JHX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JHX contains 14 α-helices and 18 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	4-8	5
α-helix	11-24	14
β-strand	28-35	8	1
α-helix	36	1
α-helix	42-44	3
β-strand	48-52	5	1
β-strand	56	1	2
α-helix	57-67	11
β-strand	77-79	3	1
β-strand	80	1	3
β-strand	83	1	3
α-helix	84-86	3
β-strand	90	1	2
α-helix	91-98	8
β-strand	105-110	6	1

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	568-569	2	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	567-569	3	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor-associated protein-like 1	A, B	protein	122	Homo sapiens	Q9H0R8 (AlphaFold model)
Ectopic P granules protein 5 homolog	C, D	protein	12	Homo sapiens	Q9HCE0 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7JHX_1 Gamma-aminobutyric acid receptor-associated protein-like 1 (chains A, B)
GPLGSMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDL
TVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVY
GK

Sequence of entity 2 (C, D), FASTA

>7JHX_2 Ectopic P granules protein 5 homolog (chains C, D)
DEDPETSWILLN

Primary citation

Insights on autophagosome-lysosome tethering from structural and biochemical characterization of human autophagy factor EPG5. Nam, S.E., Cheung, Y.W.S., Nguyen, T.N. et al. Commun Biol (2021) 4:291-291. DOI 10.1038/s42003-021-01830-x · PubMed

Other PDB entries of the same protein (UniProt Q9H0R8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YOO 1.06 Å, Structure of SAMM50 LIR bound to GABARAPL1
6HOI 1.14 Å, Structure of Beclin1 LIR motif bound to GABARAPL1
6HOL 1.4 Å, Structure of ATG14 LIR motif bound to GABARAPL1
5LXI 1.44 Å, GABARAP-L1 ATG4B LIR Complex
7AA7 1.45 Å, Structure of SCOC pS12/pS18 LIR motif bound to GABARAPL1
8X8A 1.53 Å, Crystal structure of STBD1 LIR motif in complex with GABARAPL1
5LXH 1.58 Å, GABARAP-L1 ATG4B LIR Complex
2R2Q 1.65 Å, Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1…
7AA9 1.72 Å, Structure of SCOC pT13/pT15 LIR motif bound to GABARAPL1
9JF2 1.76 Å, Crystal structure of GABARAPL1 in complex with ATG16L1
9HGC 2.52 Å, Crystal structure of human GABARAPL1 in complex with cyclic peptide GAB_D8
5DPT 2.9 Å, Crystal structure of PLEKHM1 LIR-fused human GABARAPL1_2-117

Browse structure collections

About this viewer

MolViewer shows 7JHX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.