Human PrimPol inserting correct dCTP opposite the 8-oxoguanine lesion. Determined by X-ray diffraction at 2.62 Å resolution. Released 30 Jun 2021.
Explore 7JK1 in 3D Show helices and sheets RCSB PDB PDBe
7JK1 contains 23 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-13 | 9 | |
| β-strand | 43-45 | 3 | 1 |
| α-helix | 48-56 | 9 | |
| β-strand | 63-68 | 6 | 1 |
| β-strand | 76-81 | 6 | 1 |
| α-helix | 83-88 | 6 | |
| β-strand | 99-103 | 5 | 1 |
| β-strand | 109 | 1 | 2 |
| β-strand | 112-118 | 7 | 3 |
| α-helix | 127-145 | 19 | |
| α-helix | 152-154 | 3 | |
| β-strand | 155-159 | 5 | 3 |
| β-strand | 165-172 | 8 | 3 |
| β-strand | 177-179 | 3 | 2 |
| α-helix | 182-192 | 11 | |
| α-helix | 194-197 | 4 | |
| α-helix | 263-266 | 4 | |
| β-strand | 267-269 | 3 | 4 |
| β-strand | 275-277 | 3 | 4 |
| β-strand | 279 | 1 | 3 |
| β-strand | 288-291 | 4 | 1 |
| α-helix | 292 | 1 | |
| β-strand | 296 | 1 | 5 |
| α-helix | 302 | 1 | |
| β-strand | 303 | 1 | 5 |
| α-helix | 304 | 1 | |
| β-strand | 305-306 | 2 | 3 |
| α-helix | 322-330 | 9 | |
| α-helix | 335-337 | 3 | |
| α-helix | 341 | 1 | |
| β-strand | 342-344 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 43-45 | 3 | 6 |
| α-helix | 48-58 | 11 | |
| β-strand | 63-68 | 6 | 6 |
| β-strand | 76-81 | 6 | 6 |
| α-helix | 83-90 | 8 | |
| β-strand | 99-103 | 5 | 6 |
| β-strand | 109 | 1 | 2 |
| β-strand | 112-118 | 7 | 7 |
| α-helix | 127-145 | 19 | |
| α-helix | 152-154 | 3 | |
| β-strand | 155-159 | 5 | 7 |
| β-strand | 165-172 | 8 | 7 |
| β-strand | 177-179 | 3 | 2 |
| α-helix | 182-192 | 11 | |
| α-helix | 194-197 | 4 | |
| α-helix | 263-266 | 4 | |
| β-strand | 267-269 | 3 | 8 |
| β-strand | 275-277 | 3 | 8 |
| β-strand | 279-280 | 2 | 7 |
| β-strand | 288-291 | 4 | 6 |
| α-helix | 292 | 1 | |
| β-strand | 293 | 1 | 9 |
| β-strand | 296 | 1 | 10 |
| β-strand | 303 | 1 | 10 |
| β-strand | 304 | 1 | 9 |
| β-strand | 305-306 | 2 | 7 |
| α-helix | 322-330 | 9 | |
| β-strand | 342-344 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA-directed primase/polymerase protein | A, B | protein | 354 | Homo sapiens | Q96LW4 (AlphaFold model) |
| DNA (5'-D(P*AP*(8OG)P*CP*GP*CP*TP*AP*CP*CP*AP*CP*AP*CP*CP*CP*C)-3') | C, G | DNA | 17 | synthetic construct | |
| DNA (5'-d(*gp*gp*tp*gp*tp*gp*gp*tp*ap*gp*cp*g)-3') | D, F | DNA | 12 | synthetic construct |
>7JK1_1 DNA-directed primase/polymerase protein (chains A, B) MNRKWEAKLKQIEERASHYERKPLSSVYRPRLSKPEEPPSIWRLFHRQAQAFNFVKSCKE DVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKP ANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAFK DNIHVGNFLRKILQPALDLLGSEDDDSAPETTGHGFPHFSEAPARQGFSFNKMFTEKATE ESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFVDLGVYTRNRNFRLYKSSKIGK RVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQNKQK
>7JK1_2 DNA (5'-D(P*AP*(8OG)P*CP*GP*CP*TP*AP*CP*CP*AP*CP*AP*CP*CP*CP*C)-3') (chains C, G) CAGCGCTACCACACCCC
>7JK1_3 DNA (5'-D(*GP*GP*TP*GP*TP*GP*GP*TP*AP*GP*CP*G)-3') (chains D, F) GGTGTGGTAGCG
Water and common crystallization additives (GOL, PEG) are not listed.
Structural basis of DNA synthesis opposite 8-oxoguanine by human PrimPol primase-polymerase. Rechkoblit, O., Johnson, R.E., Gupta, Y.K. et al. Nat Commun (2021) 12:4020-4020. DOI 10.1038/s41467-021-24317-z · PubMed
Other PDB entries of the same protein (UniProt Q96LW4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7JK1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.