7JM4: IRF Transcription Factor

Name: PDB 7JM4: IRF Transcription Factor
Published: 2021-03-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

IRF Transcription Factor. Determined by X-ray diffraction at 2.95 Å resolution. Released 24 Mar 2021.

Method: X-ray diffraction
Resolution: 2.95 Å
Organism: Homo sapiens
Chains: 8
Atoms: 5,204
Mol. weight: 75.72 kDa
Released: 24 Mar 2021

Explore 7JM4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7JM4 contains 16 α-helices and 24 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and H: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
β-strand	41-42	2	2
β-strand	49-53	5	2
α-helix	56-57	2
β-strand	58	1	3
β-strand	61	1	3
α-helix	68-77	10
α-helix	87-88	2
α-helix	90-103	14
β-strand	107-109	3	2
β-strand	115	1	2
β-strand	122-127	6	2

Chains B and G: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
β-strand	41-42	2	1
β-strand	49-53	5	1
α-helix	64-78	15
α-helix	90-103	14
β-strand	107-109	3	1
β-strand	115	1	1
β-strand	122-127	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon-Stimulated Response Elements	C, D	DNA	19	Homo sapiens
Interferon-Stimulated Response Elements	E, F	DNA	19	Homo sapiens
Interferon regulatory factor 4	A, B, G, H	protein	111	Homo sapiens	Q15306 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>7JM4_1 Interferon-Stimulated Response Elements (chains C, D)
CAACTGAAACCGAGAAAGC

Sequence of entity 2 (E, F), FASTA

>7JM4_2 Interferon-Stimulated Response Elements (chains E, F)
GCTTTCTCGGTTTCAGTTG

Sequence of entity 3 (A, B, G, H), FASTA

>7JM4_3 Interferon regulatory factor 4 (chains A, B, G, H)
GSNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAALFKAWALFK
GKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVP

Primary citation

Structural determinants of the IRF4/DNA homodimeric complex. Sundararaj, S., Seneviratne, S., Williams, S.J. et al. Nucleic Acids Res (2021) 49:2255-2265. DOI 10.1093/nar/gkaa1287 · PubMed

Other PDB entries of the same protein (UniProt Q15306 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TD4 1.71 Å, IRF4 DNA-binding domain surface entropy mutant apo structure
9VEH 2.0 Å, The MIDN Catch-IRF4 (A8M) fusion protein
9TOY 2.1 Å, Investigating the binding mechanism of Interferon Regulatory Factor 4 to DNA in the…
9VE3 2.1 Å, The MIDN Catch-IRF4 (V2L) fusion protein
9VE7 2.15 Å, The MIDN Catch-IRF4 (A8V) fusion protein
7OOT 2.25 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7OGS 2.37 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
7RH2 2.47 Å, IRF4 Transcription factor mutant -K59R
9CUG 2.49 Å, X-ray Structure of human Interferon Regulatory Factor 4 (IRF4) IAD Domain
9VE4 2.55 Å, The MIDN Catch-IRF4 fusion protein
7O56 2.6 Å, X-ray Structure of Interferon Regulatory Factor 4 DNA binding domain bound to an…
9VE6 2.8 Å, The MIDN Catch-IRF4 (F6Y) fusion protein

Browse structure collections

About this viewer

MolViewer shows 7JM4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.