7KLJ: WD-repeat domain of human KIF21A

Crystal structure of the WD-repeat domain of human KIF21A. Determined by X-ray diffraction at 1.52 Å resolution. Released 16 Dec 2020.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,573
Mol. weight: 73.63 kDa
Released: 16 Dec 2020

Explore 7KLJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KLJ contains 6 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1338-1344	7	1
β-strand	1350-1355	6	2
β-strand	1359-1364	6	2
β-strand	1369-1373	5	2
β-strand	1379-1383	5	2
β-strand	1392-1396	5	3
β-strand	1401-1406	6	3
β-strand	1409-1414	6	3
β-strand	1420-1426	7	3
β-strand	1431-1433	3	3
α-helix	1440-1441	2
β-strand	1454-1459	6	4
β-strand	1465-1470	6	4
β-strand	1473-1478	6	4
β-strand	1483-1488	6	4
β-strand	1495-1504	10	5
β-strand	1507-1514	8	5
β-strand	1519-1525	7	5
β-strand	1530-1532	3	4
β-strand	1536-1537	2	5
α-helix	1541-1542	2
β-strand	1546-1552	7	6
β-strand	1555-1560	6	6
β-strand	1565-1569	5	6
β-strand	1574-1579	6	6
β-strand	1587-1592	6	7
α-helix	1593	1
β-strand	1598-1603	6	7
β-strand	1607-1612	6	7
β-strand	1618-1623	6	7
β-strand	1629-1634	6	1
β-strand	1639-1643	5	1
β-strand	1647-1652	6	1

Chain B: 3 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1338-1343	6	8
β-strand	1350-1355	6	9
β-strand	1359-1364	6	9
β-strand	1369-1373	5	9
β-strand	1379-1383	5	9
β-strand	1392-1396	5	10
β-strand	1401-1406	6	10
β-strand	1409-1414	6	10
β-strand	1420-1426	7	10
β-strand	1431-1433	3	10
α-helix	1446-1448	3
β-strand	1454-1459	6	11
β-strand	1465-1470	6	11
β-strand	1473-1478	6	11
β-strand	1483-1488	6	11
β-strand	1495-1504	10	12
β-strand	1507-1514	8	12
β-strand	1519-1525	7	12
β-strand	1530-1532	3	11
β-strand	1536-1537	2	12
α-helix	1541-1542	2
β-strand	1546-1552	7	13
β-strand	1555-1560	6	13
β-strand	1565-1569	5	13
β-strand	1574-1579	6	13
β-strand	1587-1592	6	14
α-helix	1593	1
β-strand	1598-1603	6	14
β-strand	1607-1612	6	14
β-strand	1618-1623	6	14
β-strand	1629-1634	6	8
β-strand	1639-1643	5	8
β-strand	1648-1652	5	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 2 of Kinesin-like protein KIF21A	A, B	protein	335	Homo sapiens	Q7Z4S6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7KLJ_1 Isoform 2 of Kinesin-like protein KIF21A (chains A, B)
MHHHHHHSSGRENLYFQGLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQ
EIMSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACS
ASTSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCL
TVDQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFS
GSRDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMP
VGEMKGHDSPINAICVNSTHIFTAADDRTVRIWKA

Primary citation

Crystal structure of the WD-repeat domain of human KIF21A. Zeng, H., Dong, A., Loppnau, P. et al. To be published.

Other PDB entries of the same protein (UniProt Q7Z4S6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YBU 1.89 Å, Structure of the KANK1 ankyrin domain in complex with KIF21A peptide
5YBV 2.12 Å, The structure of the KANK2 ankyrin domain with the KIF21A peptide
5NFD 2.18 Å, Antiparallel monomeric coiled coil of Kif21A
5D3A 2.5 Å, KIF21A regulatory coiled coil

Browse structure collections

About this viewer

MolViewer shows 7KLJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.