7KWO: Rfviiifc-vwf-xten

Rfviiifc-vwf-xten (BIVV001). Determined by electron microscopy at 2.9 Å resolution. Released 3 Mar 2021.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 13,469
Mol. weight: 399.38 kDa
Ligands: NAG, CA, ZN, CU
Released: 3 Mar 2021

Explore 7KWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7KWO contains 44 α-helices and 142 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 106 β-strands

Element	Residues	Length	Sheet
β-strand	2-14	13	1
β-strand	46-53	8	1
β-strand	54	1	2
β-strand	62	1	2
α-helix	63-64	2
β-strand	76-79	4	3
β-strand	83-89	7	1
β-strand	96	1	4
β-strand	99-100	2	3
β-strand	104-105	2	1
α-helix	120-122	3
β-strand	128	1	4
β-strand	133-139	7	1
β-strand	153-159	7	3
α-helix	164-170	7
β-strand	173-179	7	3
α-helix	180	1
β-strand	194-203	10	5
α-helix	204-206	3
α-helix	229	1
β-strand	230-234	5	5
β-strand	237	1	5
β-strand	246-247	2	6
β-strand	252-260	9	5
β-strand	267-271	5	6
β-strand	276-278	3	5
β-strand	281-283	3	5
β-strand	286-288	3	6
β-strand	292-299	8	5
β-strand	304-310	7	6
α-helix	313-315	3
β-strand	321-326	6	6
β-strand	381-394	14	7
α-helix	407-411	5
β-strand	415	1	8
β-strand	418	1	8
β-strand	422-431	10	7
β-strand	439	1	7
α-helix	440-442	3
α-helix	451-452	2
β-strand	453-456	4	9
β-strand	460-467	8	7
β-strand	473	1	10
β-strand	476-477	2	9
β-strand	482-485	4	7
β-strand	503	1	10
β-strand	508-514	7	7
β-strand	528-534	7	9
α-helix	539-545	7
β-strand	548-554	7	9
β-strand	572-580	9	11
α-helix	581-583	3
α-helix	587-594	8
α-helix	606-610	5
β-strand	613-617	5	11
β-strand	620	1	11
β-strand	626-630	5	12
β-strand	634-641	8	11
β-strand	649-653	5	12
β-strand	658-660	3	11
β-strand	663-665	3	11
β-strand	668-670	3	12
β-strand	674-681	8	11
β-strand	686-692	7	12
α-helix	695-699	5
β-strand	704-709	6	12
β-strand	1677-1678	2	13
β-strand	1695-1707	13	14
β-strand	1730-1737	8	14
β-strand	1738	1	15
β-strand	1746	1	15
α-helix	1747-1749	3
α-helix	1754-1756	3
β-strand	1763-1766	4	16
β-strand	1770-1777	8	14
β-strand	1783	1	17
β-strand	1786-1787	2	16
β-strand	1807	1	17
β-strand	1812-1818	7	14
α-helix	1821-1823	3
β-strand	1832-1838	7	16
α-helix	1845-1849	5
β-strand	1853-1858	6	16
β-strand	1874-1884	11	18
α-helix	1885-1887	3
α-helix	1891-1898	8
α-helix	1913-1916	4
β-strand	1917-1921	5	18
β-strand	1924	1	18
β-strand	1933-1935	3	19
β-strand	1940-1946	7	18
β-strand	1954-1958	5	19
β-strand	1963-1966	4	18
β-strand	1970-1973	4	18
β-strand	1975-1978	4	19
α-helix	1979	1
β-strand	1983-1988	6	18
β-strand	1994-2000	7	19
α-helix	2003-2007	5
β-strand	2011-2017	7	19
β-strand	2023-2024	2	20
α-helix	2034-2036	3
β-strand	2037-2039	3	20
α-helix	2048-2050	3
β-strand	2052	1	20
β-strand	2062	1	21
β-strand	2071-2087	17	20
β-strand	2089-2090	2	22
β-strand	2095-2096	2	22
β-strand	2098-2106	9	20
β-strand	2113-2114	2	20
α-helix	2124-2125	2
β-strand	2126-2127	2	20
β-strand	2136-2156	21	20
β-strand	2162	1	21
β-strand	2163-2169	7	20
β-strand	2176-2177	2	23
α-helix	2187-2189	3
β-strand	2190-2192	3	23
β-strand	2197	1	24
β-strand	2202	1	24
α-helix	2205-2207	3
β-strand	2209	1	23
β-strand	2219	1	25
β-strand	2230-2246	17	23
β-strand	2248-2250	3	26
β-strand	2253-2255	3	26
β-strand	2256-2265	10	23
β-strand	2271-2273	3	23
β-strand	2275-2276	2	27
β-strand	2279-2280	2	27
α-helix	2281-2282	2
β-strand	2283-2284	2	23
β-strand	2293-2314	22	23
β-strand	2319	1	25
β-strand	2320-2327	8	23

Chain V: 14 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	772-774	3	28
β-strand	791	1	13
β-strand	807-809	3	28
β-strand	814-817	4	13
β-strand	820-823	4	13
α-helix	824-826	3
α-helix	827-828	2
β-strand	829-831	3	29
β-strand	834-836	3	29
β-strand	841-844	4	30
β-strand	847-852	6	30
β-strand	855-860	6	30
β-strand	864-870	7	31
β-strand	874-876	3	31
β-strand	882-884	3	31
β-strand	890-895	6	32
β-strand	905-912	8	32
α-helix	918-920	3
β-strand	922-929	8	32
β-strand	932-937	6	32
β-strand	940-945	6	32
β-strand	953-958	6	31
β-strand	961-966	6	31
β-strand	970-974	5	31
β-strand	980-985	6	31
α-helix	986-988	3
β-strand	993	1	32
β-strand	1008	1	33
β-strand	1014	1	33
α-helix	1018-1024	7
β-strand	1026	1	32
α-helix	1032-1036	5
α-helix	1050-1060	11
α-helix	1061-1064	4
α-helix	1069-1071	3
α-helix	1077-1088	12
α-helix	1098-1113	16
α-helix	1136-1138	3
β-strand	1143-1150	8	34
β-strand	1156	1	35
β-strand	1170-1176	7	34
β-strand	1182-1184	3	35
β-strand	1189-1191	3	35
α-helix	1193-1195	3
β-strand	1198-1201	4	36
β-strand	1204-1207	4	36
β-strand	1211-1214	4	37
β-strand	1223-1227	5	37
β-strand	1232-1236	5	37
α-helix	1237-1239	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor FVIII-Fc-XTEN	A	protein	1965	Homo sapiens	P00451 (AlphaFold model)
von Willebrand factor-XTEN-Fc	V	protein	1646	Homo sapiens	P01857 (AlphaFold model), P04275 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7KWO_1 Coagulation factor FVIII-Fc-XTEN (chains A)
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFN
TSVVYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAV
GVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSH
VDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRD
AASARAWPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNH
RQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNE
EAEDYDDDLTDSEMDVVRFDDDNSPSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLA
PDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDFPILPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQIMSDKRNVILFSVFDE
NRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILS
IGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRG
MTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNGTSESATPESGPGSEP
ATSGSETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPA
GSPTSTEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPA
GSPTSTEEGTSTEPSEGSAPGTSESATPESGPGTSESATPESGPGTSESATPESGPGSEP
ATSGSETPGSEPATSGSETPGSPAGSPTSTEEGTSTEPSEGSAPGTSTEPSEGSAPGSEP
ATSGSETPGTSESATPESGPGTSTEPSEGSAPASSEITRTTLQSDQEEIDYDDTISVEMK
KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKV
VFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYE
EDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIG
PLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFK
ENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKM
ALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIR
DFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKF
SSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHP
THYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQ
GRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTL
FFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLYD
KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG
VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKG
QPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

Sequence of entity 2 (V), FASTA

>7KWO_2 von Willebrand factor-XTEN-Fc (chains V)
MIPARFAGVLLALALILPGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYL
LAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTL
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTLCECAGGLECACPALLEYARTCAQEGMVLYGWTDHSACSPVCPAGME
YRQCVSPCARTCQSLHINEMCQERCVDGCSCPEGQLLDEGLCVESTECPCVHSGKRYPPG
TSLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCQD
HSFSIVIETVQCADDRDAVCTRSVTVRLPGLHNSLVKLKHGAGVAMDGQDIQLPLLKGDL
RIQHTVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHGDCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELNCPKGQVYLQ
CGTPCNLTCRSLSYPDEECNEACLEGCFCPPGLYMDERGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
LRAEGLECTKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCFHQGKEYAPGE
TVKIGCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYLFPGECQYVLVQDYCGS
NPGTFRILVGNKGCSHPSVKCKKRVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKALSVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWKVSSQCADTRKVPLDSSPATCHNNIMKQTMVDSSCRILTSDVFQDCNKLVDPEPY
LDVCIYDTCSCESIGDCAAFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY
EAEWRYNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCVDPEDCPVCE
VAGRRFASGKKVTLNPSDPEHCQICHCDVVNLTCEACQEPGTSESATPESGPGSEPATSG
SETPGTSESATPESGPGSEPATSGSETPGTSESATPESGPGTSTEPSEGSAPGSPAGSPT
STEEGTSESATPESGPGSEPATSGSETPGTSESATPESGPGSPAGSPTSTEEGSPAGSPT
STEEGASSDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSDKTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY
RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK
NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG
NVFSCSVMHEALHNHYTQKSLSLSPG

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
CA	Calcium ion	Ca	2
ZN	Zinc ion	Zn	1
CU	Copper (II) ion	Cu	1

Primary citation

Molecular determinants of the factor VIII/von Willebrand factor complex revealed by BIVV001 cryo-electron microscopy. Fuller, J.R., Knockenhauer, K.E., Leksa, N.C. et al. Blood (2021) 137:2970-2980. DOI 10.1182/blood.2020009197 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
9JBV 3.17 Å, Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation…
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII

Browse structure collections

About this viewer

MolViewer shows 7KWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.