9JBV: Coagulation factor VIII

Structure of Engineered Coagulation Factor VIII with Enhanced Secretion and Coagulation Potential. Determined by electron microscopy at 3.17 Å resolution. Released 10 Sept 2025.

Method: Electron microscopy
Resolution: 3.17 Å
Organism: Homo sapiens
Chains: 1
Atoms: 10,291
Mol. weight: 167.45 kDa
Released: 10 Sept 2025

Explore 9JBV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9JBV contains 27 α-helices and 110 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 110 β-strands

Element	Residues	Length	Sheet
β-strand	21-24	4	1
β-strand	27-33	7	1
β-strand	65-70	6	1
β-strand	73	1	2
β-strand	81	1	2
α-helix	82-83	2
α-helix	92-93	2
β-strand	94-97	4	3
β-strand	102-109	8	1
β-strand	115	1	4
β-strand	118-119	2	5
α-helix	139-142	4
β-strand	147	1	4
β-strand	152-156	5	1
α-helix	161-163	3
β-strand	172-175	4	3
β-strand	177-178	2	5
α-helix	184-188	5
β-strand	192	1	5
β-strand	194-198	5	3
α-helix	202-208	7
β-strand	213-219	7	6
β-strand	222	1	7
α-helix	231-233	3
β-strand	249	1	7
β-strand	253	1	8
β-strand	256	1	8
β-strand	267	1	9
β-strand	270-279	10	6
β-strand	286-290	5	10
β-strand	293	1	10
β-strand	295-297	3	11
β-strand	300-302	3	11
β-strand	305-307	3	10
β-strand	312-319	8	6
β-strand	323-329	7	10
α-helix	332-335	4
β-strand	340-345	6	10
β-strand	346	1	9
β-strand	403-413	11	12
α-helix	420-422	3
α-helix	426-430	5
β-strand	441-450	10	12
β-strand	458	1	12
β-strand	472-475	4	13
β-strand	479-485	7	12
β-strand	495-496	2	13
β-strand	502-503	2	12
α-helix	510-511	2
β-strand	529-533	5	12
β-strand	547-553	7	13
α-helix	560-563	4
β-strand	567-573	7	13
α-helix	574	1
β-strand	578	1	14
β-strand	584	1	14
β-strand	590-594	5	15
β-strand	595-599	5	16
α-helix	600-602	3
α-helix	607-613	7
α-helix	617-619	3
α-helix	625-631	7
β-strand	632-636	5	16
β-strand	639	1	16
β-strand	645	1	17
β-strand	648-649	2	18
β-strand	652-660	9	15
β-strand	668-671	4	17
β-strand	672	1	19
β-strand	675	1	19
β-strand	677-679	3	15
β-strand	682-684	3	15
β-strand	687-689	3	17
β-strand	693-701	9	15
β-strand	706-711	6	17
α-helix	714-719	6
β-strand	722-726	5	17
β-strand	727-728	2	18
β-strand	822-832	11	20
β-strand	855-862	8	20
β-strand	863	1	21
β-strand	871	1	21
α-helix	879-881	3
β-strand	890	1	22
β-strand	896-901	6	20
β-strand	911-912	2	23
α-helix	918-922	5
β-strand	927	1	17
α-helix	928	1
β-strand	937-942	6	20
β-strand	957-958	2	22
β-strand	962-963	2	23
α-helix	968-974	7
β-strand	978	1	23
β-strand	982-983	2	22
β-strand	989	1	24
β-strand	994	1	24
β-strand	999-1009	11	25
α-helix	1010-1012	3
α-helix	1016-1023	8
α-helix	1035-1041	7
β-strand	1042-1046	5	25
β-strand	1049	1	25
β-strand	1051	1	26
β-strand	1058-1060	3	26
β-strand	1065-1071	7	25
β-strand	1079-1083	5	26
β-strand	1088-1091	4	25
β-strand	1095-1098	4	25
β-strand	1100-1103	4	26
β-strand	1107-1110	4	25
β-strand	1112-1113	2	25
β-strand	1119-1125	7	26
α-helix	1129-1133	5
β-strand	1136-1142	7	26
β-strand	1149	1	27
β-strand	1162-1164	3	27
β-strand	1196-1209	14	27
β-strand	1214-1215	2	28
β-strand	1220-1221	2	28
β-strand	1226-1231	6	27
β-strand	1238-1239	2	27
β-strand	1251	1	27
β-strand	1263-1278	16	27
β-strand	1291-1294	4	27
β-strand	1302	1	29
α-helix	1330-1332	3
β-strand	1357-1370	14	29
β-strand	1373-1375	3	30
β-strand	1378-1380	3	30
β-strand	1384-1390	7	29
β-strand	1397-1398	2	29
β-strand	1400-1401	2	31
β-strand	1404-1405	2	31
β-strand	1408-1409	2	29
β-strand	1418-1437	20	29
β-strand	1448-1452	5	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coagulation factor VIII	A	protein	1457	Homo sapiens	P00451 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9JBV_1 Coagulation factor VIII (chains A)
MQIELSTCFFLCLLPFCFSATRRYYLGAVELSWDYMQSDLGELHVDTRFPPRVPKSFPFN
TSVVYKKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAV
GVSYWKASEGAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPPCLTYSYLSH
VDLVKDLNSGLIGALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETNNSLTQDRD
AASARAQPKMHTVNGYVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNH
RQASLEISPITFLTAQTLLMDLGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNE
EAEDYDDDLTDSEMDVVRFDDDNSPPFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLA
PDDRSYKSLYLNNGPQRIGRKYKKVRFMAYTDETFKTREAIQHESGILGPLLYGEVGDTL
LIIFKNQASRPYNIYPHGITDVRPLHSGRLPKGVKHLKDMPILPGEIFKYKWTVTVEDGP
TKSDPRCLTRYYSSFVNLERDLASGLIGPLLICYKESVDQRGNQMMSDKRNVILFSVFDE
NRSWYLTENIQRFLPNPAGVQPEDPEFQASNIMHSINGYVFDSLQLSVCLHEVAYWYILS
VGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSDFRNRG
MTALLKVSSCDKNTGDYYEDSYEDIPAYLLSKNNVIEPRSFSQNPPVLKRHQREITRTTL
QPDEEKIDYDDTFSVEMKKEDFDIYGEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSP
HVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTF
KNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAW
AYFSDVDLEKDVHSGLIGPLLVCRTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENM
ERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHS
IHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKVGIWRVECLIGEHLQAGMSTLFL
VYSKKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDL
LAPMIIHGIMTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGI
KHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSY
LTNMFATWSPSQARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSM
YVKEFLISSSQDGHQWTLFLQNGKVKVFQGNQDSFTPVVNALDPPLLTRYLRIHPQSWAH
HIALRLEVLGCEAQDLY

Primary citation

Engineered coagulation factor VIII with enhanced secretion and coagulation potential for hemophilia A gene therapy. Kashiwakura, Y., Nakajima, Y., Horinaka, K. et al. Blood (2026) 147:402-415. DOI 10.1182/blood.2025028481 · PubMed

Other PDB entries of the same protein (UniProt P00451 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3HNY 1.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
3HNB 1.15 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
1D7P 1.5 Å, Crystal structure of the c2 domain of human factor viii at 1.5 a resolution at 1.5 A
9D5D 1.83 Å, Crystal Structure of Blood Coagulation Factor VIII C2 Domain Mutant L2251A/L2252A
1IQD 2.0 Å, Human Factor VIII C2 Domain complexed to human monoclonal BO2C11 Fab.
3HOB 2.07 Å, Factor VIII Trp2313-His2315 segment is involved in membrane binding as shown by crystal…
4PT6 2.1 Å, The discobody: an engineered discoidin domain from factor VIII that binds v 3 integrin…
4KI5 2.47 Å, Cystal structure of human factor VIII C2 domain in a ternary complex with murine…
4XZU 2.61 Å, Crystal Structure of the Human Factor VIII C2 Domain in Complex with Murine 3E6…
7KWO 2.9 Å, Rfviiifc-vwf-xten (BIVV001)
36JL 3.15 Å, Coagulation factor VIII, full-length, membrane-bound, on Ptd-choline : Ptd-serine 75:25…
6MF0 3.2 Å, Crystal Structure Determination of Human/Porcine Chimera Coagulation Factor VIII

Browse structure collections

About this viewer

MolViewer shows 9JBV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.