7L70: PDB entry 7L70

Name: PDB 7L70: The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form
Published: 2021-03-24
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: translation

The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form. Determined by electron microscopy at 2.8 Å resolution. Released 24 Mar 2021.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 10
Atoms: 24,187
Mol. weight: 530.26 kDa
Released: 24 Mar 2021

Explore 7L70 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7L70 contains 139 α-helices and 183 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	44-48	5	1
α-helix	59-61	3
α-helix	75-86	12
β-strand	90-95	6	1
α-helix	99-106	8
α-helix	110-112	3
β-strand	119-124	6	1
α-helix	131-141	11
β-strand	148-152	5	1
β-strand	155-157	3	2
α-helix	162-174	13
β-strand	179-186	8	1
β-strand	201-206	6	1
β-strand	211-217	7	1
β-strand	223-226	4	3
α-helix	229-233	5
β-strand	238-241	4	1
β-strand	245-252	8	1
α-helix	254-262	9
α-helix	270-278	9
β-strand	286-292	7	1
β-strand	297-299	3	2
α-helix	303-314	12
β-strand	336-338	3	4
α-helix	339-341	3
β-strand	342-344	3	4
α-helix	350-351	2
β-strand	355-356	2	5
β-strand	361	1	4
β-strand	367	1	6
β-strand	373-375	3	5
β-strand	378-379	2	4
β-strand	384	1	6
β-strand	390-392	3	5
β-strand	395-396	2	4
β-strand	401-402	2	6
β-strand	407-409	3	5
β-strand	412-413	2	4
β-strand	418-419	2	6
β-strand	424-425	2	5
β-strand	430-431	2	4
β-strand	436-437	2	6
β-strand	442	1	5
α-helix	443-444	2
β-strand	448-450	3	4
β-strand	457-458	2	4

Chain B: 13 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	44-48	5	7
α-helix	59-61	3
α-helix	75-86	12
β-strand	90-95	6	7
α-helix	99-106	8
α-helix	110-112	3
β-strand	119-124	6	7
α-helix	131-141	11
β-strand	148-152	5	7
β-strand	155-157	3	8
α-helix	162-174	13
β-strand	179-186	8	7
β-strand	201-206	6	7
β-strand	211-217	7	7
β-strand	223-227	5	9
α-helix	229-233	5
β-strand	238-241	4	7
β-strand	245-252	8	7
α-helix	254-262	9
α-helix	270-278	9
β-strand	286-292	7	7
β-strand	297-299	3	8
α-helix	303-314	12
β-strand	336-338	3	10
α-helix	339-341	3
β-strand	342-344	3	10
α-helix	350-351	2
β-strand	355-356	2	11
β-strand	361	1	10
β-strand	367	1	12
β-strand	373-375	3	11
β-strand	378-379	2	10
β-strand	384	1	12
β-strand	390-392	3	11
β-strand	395-396	2	10
β-strand	401-402	2	12
β-strand	407-409	3	11
β-strand	412-413	2	10
β-strand	418-419	2	12
β-strand	424-425	2	11
β-strand	430-431	2	10
β-strand	436-437	2	12
β-strand	442	1	11
α-helix	443-444	2
β-strand	448-450	3	10
β-strand	457-458	2	10

Chain C: 13 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-24	16
α-helix	31-47	17
α-helix	54-71	18
α-helix	78-97	20
α-helix	129-152	24
β-strand	163-168	6	13
α-helix	172-182	11
β-strand	187-192	6	13
α-helix	200-208	9
β-strand	214-217	4	13
β-strand	231-234	4	13
β-strand	238-239	2	14
β-strand	245-248	4	14
α-helix	251-260	10
β-strand	265-268	4	13
α-helix	271-273	3
β-strand	274	1	14
β-strand	288	1	15
α-helix	301-305	5
β-strand	306-308	3	16
β-strand	311	1	15
β-strand	313-316	4	14
β-strand	323-325	3	13
β-strand	331	1	13
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain D: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	9-24	16
α-helix	31-47	17
α-helix	54-71	18
α-helix	78-97	20
α-helix	129-152	24
β-strand	163-168	6	17
α-helix	172-179	8
β-strand	187-192	6	17
α-helix	193-194	2
α-helix	200-209	10
β-strand	214-217	4	17
α-helix	222-225	4
β-strand	231-234	4	17
β-strand	239	1	18
β-strand	245	1	18
β-strand	248	1	19
α-helix	251-261	11
β-strand	265-268	4	17
α-helix	271-273	3
β-strand	274	1	18
β-strand	288	1	20
α-helix	301-304	4
β-strand	307-308	2	21
β-strand	311	1	20
β-strand	313	1	19
β-strand	316	1	18
α-helix	318-320	3
β-strand	323-326	4	17
β-strand	329-331	3	17
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain E: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	168-171	4
α-helix	175-177	3
β-strand	185	1	22
α-helix	192-195	4
α-helix	205-215	11
α-helix	222-239	18
α-helix	242-243	2
α-helix	248-266	19
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-324	11
β-strand	332-336	5	21
α-helix	340-351	12
β-strand	357-362	6	21
α-helix	369-379	11
β-strand	384-387	4	21
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	21
β-strand	408	1	23
β-strand	414	1	23
β-strand	417	1	24
α-helix	418-429	12
β-strand	434-437	4	21
α-helix	440-442	3
β-strand	443	1	23
β-strand	457	1	22
α-helix	460-462	3
β-strand	467	1	25
β-strand	470	1	25
β-strand	482-484	3	17
β-strand	487	1	22
β-strand	489	1	24
β-strand	492	1	23
α-helix	494-496	3
β-strand	499-501	3	21
β-strand	507-508	2	21
α-helix	512-516	5

Chain F: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	185	1	26
α-helix	205-216	12
α-helix	222-238	17
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-322	9
β-strand	332-336	5	16
α-helix	342-352	11
β-strand	357-362	6	16
α-helix	369-377	9
β-strand	383-387	5	16
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	16
β-strand	407-408	2	27
β-strand	414-417	4	27
α-helix	421-429	9
β-strand	434-437	4	16
α-helix	440-442	3
β-strand	443	1	27
β-strand	457	1	26
α-helix	460-463	4
α-helix	476-478	3
β-strand	483-484	2	13
β-strand	487	1	26
β-strand	489-492	4	27
α-helix	494-496	3
β-strand	499-501	3	16
β-strand	506-507	2	16
α-helix	512-516	5

Chain G: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	22-34	13
α-helix	45-59	15
α-helix	63-76	14
α-helix	91-115	25
α-helix	116-118	3
β-strand	124-127	4	28
α-helix	132-142	11
β-strand	149-153	5	28
α-helix	161-169	9
β-strand	175-178	4	28
α-helix	180-182	3
β-strand	192-196	5	28
β-strand	199-200	2	29
β-strand	206-208	3	29
α-helix	213-220	8
β-strand	226-229	4	28
α-helix	232-234	3
β-strand	235	1	29
α-helix	248-251	4
β-strand	274-276	3	29
α-helix	278-280	3
β-strand	283-286	4	28
β-strand	289-291	3	28
α-helix	296-303	8

Chain H: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
α-helix	22-34	13
α-helix	45-59	15
α-helix	63-75	13
α-helix	92-105	14
α-helix	107-115	9
α-helix	116-118	3
β-strand	124-127	4	30
α-helix	132-142	11
β-strand	149-153	5	30
α-helix	161-169	9
β-strand	177-178	2	30
α-helix	187-189	3
β-strand	192-195	4	30
β-strand	199-200	2	31
β-strand	206-209	4	31
α-helix	213-221	9
β-strand	226-229	4	30
α-helix	232-234	3
β-strand	235	1	31
α-helix	248-251	4
β-strand	273-276	4	31
α-helix	278-280	3
β-strand	283-286	4	30
β-strand	289-291	3	30
α-helix	295-303	9

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF-2B subunit epsilon	A, B	protein	721	Homo sapiens	Q13144 (AlphaFold model)
Translation initiation factor eIF-2B subunit beta	C, D	protein	368	Homo sapiens	P49770 (AlphaFold model)
Translation initiation factor eIF-2B subunit delta	E, F	protein	523	Homo sapiens	Q9UI10 (AlphaFold model)
Translation initiation factor eIF-2B subunit alpha	G, H	protein	322	Homo sapiens	Q14232 (AlphaFold model)
Translation initiation factor eIF-2B subunit gamma	I, J	protein	452	Homo sapiens	Q9NR50

Sequence of entity 1 (A, B), FASTA

>7L70_1 Translation initiation factor eIF-2B subunit epsilon (chains A, B)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNVSLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D

Sequence of entity 2 (C, D), FASTA

>7L70_2 Translation initiation factor eIF-2B subunit beta (chains C, D)
MHHHHHHGGGSENLYFQSPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLR
QIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDES
DQQESLHKLLTSGGLNEDFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNE
VIMTIGFSRTVEAFLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIF
AVMSRVNKVIIGTKTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEED
SFHKFVAPEEVLPFTEGDILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSEL
YHPDDHVL

Sequence of entity 3 (E, F), FASTA

>7L70_3 Translation initiation factor eIF-2B subunit delta (chains E, F)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Sequence of entity 4 (G, H), FASTA

>7L70_4 Translation initiation factor eIF-2B subunit alpha (chains G, H)
MHHHHHHGGGSENLYFQSDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQ
GLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRR
ISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKK
MAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQN
KPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITL
LFTDLGVLTPSAVSDELIKLYL

Sequence of entity 5 (I, J), FASTA

>7L70_5 Translation initiation factor eIF-2B subunit gamma (chains I, J)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Primary citation

eIF2B conformation and assembly state regulates the integrated stress response. Schoof, M., Boone, M., Wang, L. et al. Elife (2021) 10. DOI 10.7554/eLife.65703 · PubMed

Other PDB entries of the same protein (UniProt Q13144 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3JUI 2.0 Å, Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B…
9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
9Y5T 2.78 Å, eIF2B lacking the latch helix bound to ISRACT-02 (Active state)
6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…

Browse structure collections

About this viewer

MolViewer shows 7L70 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.