Crystal structure of the first bromodomain (BD1) of human BRD3 bound to SG3-179. Determined by X-ray diffraction at 1.45 Å resolution. Released 14 Jul 2021.
Explore 7LAY in 3D Show helices and sheets RCSB PDB PDBe
7LAY contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-41 | 5 | |
| α-helix | 42-47 | 6 | |
| α-helix | 48-52 | 5 | |
| α-helix | 57-59 | 3 | |
| α-helix | 73-76 | 4 | |
| α-helix | 83-91 | 9 | |
| α-helix | 98-115 | 18 | |
| α-helix | 121-138 | 18 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 37-41 | 5 | |
| α-helix | 42-47 | 6 | |
| α-helix | 48-51 | 4 | |
| α-helix | 57-59 | 3 | |
| α-helix | 65-68 | 4 | |
| α-helix | 73-76 | 4 | |
| α-helix | 83-91 | 9 | |
| α-helix | 98-115 | 18 | |
| α-helix | 121-137 | 17 | |
| α-helix | 140-143 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bromodomain-containing protein 3 | A, B | protein | 123 | Homo sapiens | Q15059 (AlphaFold model) |
>7LAY_1 Bromodomain-containing protein 3 (chains A, B) SMPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPM DMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMP QEE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 5W2 | 4-[[4-[[3-(~{tert}-butylsulfonylamino)-4-chloranyl-phenyl]amino]-5-methyl-pyrim… | C28 H35 Cl F N7 O3 S | 2 |
Water and common crystallization additives (DMS, EDO) are not listed.
Differential BET Bromodomain Inhibition by Dihydropteridinone and Pyrimidodiazepinone Kinase Inhibitors. Karim, R.M., Bikowitz, M.J., Chan, A. et al. J Med Chem (2021) 64:15772-15786. DOI 10.1021/acs.jmedchem.1c01096 · PubMed
Other PDB entries of the same protein (UniProt Q15059 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7LAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.