7M2G: INTERLEUKIN-2 (human) mutant P65K, C125S

INTERLEUKIN-2 (human) mutant P65K, C125S. Determined by X-ray diffraction at 1.79 Å resolution. Released 4 Aug 2021.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,240
Mol. weight: 15.64 kDa
Released: 4 Aug 2021

Explore 7M2G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M2G contains 10 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	25-48	24
α-helix	56-59	4
β-strand	64	1	1
β-strand	67	1	2
α-helix	73-76	4
α-helix	77-80	4
α-helix	83-90	8
α-helix	95-97	3
α-helix	102-116	15
α-helix	124-126	3
β-strand	127	1	2
α-helix	128	1
β-strand	132	1	1
α-helix	134-151	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-2	A	protein	133	Homo sapiens	P60568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7M2G_1 Interleukin-2 (chains A)
APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRMLTFKFYMPKKATELKHLQCLE
EELKKLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSETTFMCEYADETATIVEFLNR
WITFSQSIISTLT

Primary citation

An engineered IL-2 reprogrammed for anti-tumor therapy using a semi-synthetic organism. Ptacin, J.L., Caffaro, C.E., Ma, L. et al. Nat Commun (2021) 12:4785-4785. DOI 10.1038/s41467-021-24987-9 · PubMed

Other PDB entries of the same protein (UniProt P60568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SOZ 1.64 Å, Structure of the complex formed by human interleukin-2 and scFv 602
8SOW 1.71 Å, Structure of the complex formed by human interleukin-2 and scFv F10
4NEJ 1.92 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
4NEM 1.93 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
1M48 1.95 Å, Crystal Structure of Human IL-2 Complexed with (R)-N-[2-[1-(Aminoiminomethyl)-3-piperidin…
5LQB 1.95 Å, Complex structure of human IL2 mutant, Proleukin, with Fab fragment of NARA1 antibody
1M47 1.99 Å, Crystal Structure of Human Interleukin-2
1M49 2.0 Å, Crystal Structure of Human Interleukin-2 Complexed with SP-1985
1M4B 2.15 Å, Crystal Structure of Human Interleukin-2 K43C Covalently Modified at C43 with…
1M4A 2.18 Å, Crystal Structure of Human Interleukin-2 Y31C Covalently Modified at C31 with…
1NBP 2.2 Å, Crystal Structure Of Human Interleukin-2 Y31C Covalently Modified At C31 With…
7RA9 2.2 Å, Designed StabIL-2 seq1

Browse structure collections

About this viewer

MolViewer shows 7M2G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.