7RA9: Designed StabIL-2 seq1

Designed StabIL-2 seq1. Determined by X-ray diffraction at 2.2 Å resolution. Released 16 Mar 2022.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,092
Mol. weight: 15.66 kDa
Ligands: PO4
Released: 16 Mar 2022

Explore 7RA9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RA9 contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	37-44	8
β-strand	48-51	4	1
α-helix	57-60	4
α-helix	61-64	4
α-helix	67-75	9
α-helix	81-99	19
β-strand	109-114	6	1
α-helix	116-134	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-2	A	protein	132	Homo sapiens	P60568 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7RA9_1 Interleukin-2 (chains A)
MAPTSSSTKKTQLQLEHLLLDLQMILNMLNNYDNPKLTRLLTFKFYMPKKATSLKHLQCL
EEELKPLEEALNAAGDDPKTIRDVVSNINVFVLELKGSETTFMCEYADETATIIEFLNRW
ITFCQSIISTLT

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	3

Water and common crystallization additives (EPE) are not listed.

Primary citation

Interleukin-2 superkines by computational design. Ren, J., Chu, A.E., Jude, K.M. et al. Proc Natl Acad Sci U S A (2022) 119:e2117401119-e2117401119. DOI 10.1073/pnas.2117401119 · PubMed

Other PDB entries of the same protein (UniProt P60568 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SOZ 1.64 Å, Structure of the complex formed by human interleukin-2 and scFv 602
8SOW 1.71 Å, Structure of the complex formed by human interleukin-2 and scFv F10
7M2G 1.79 Å, INTERLEUKIN-2 (human) mutant P65K, C125S
4NEJ 1.92 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
4NEM 1.93 Å, Small molecular fragment bound to crystal contact interface of Interleukin-2
1M48 1.95 Å, Crystal Structure of Human IL-2 Complexed with (R)-N-[2-[1-(Aminoiminomethyl)-3-piperidin…
5LQB 1.95 Å, Complex structure of human IL2 mutant, Proleukin, with Fab fragment of NARA1 antibody
1M47 1.99 Å, Crystal Structure of Human Interleukin-2
1M49 2.0 Å, Crystal Structure of Human Interleukin-2 Complexed with SP-1985
1M4B 2.15 Å, Crystal Structure of Human Interleukin-2 K43C Covalently Modified at C43 with…
1M4A 2.18 Å, Crystal Structure of Human Interleukin-2 Y31C Covalently Modified at C31 with…
1NBP 2.2 Å, Crystal Structure Of Human Interleukin-2 Y31C Covalently Modified At C31 With…

Browse structure collections

About this viewer

MolViewer shows 7RA9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.