7M5A: Human BAK

Name: PDB 7M5A: Crystal Structure of human BAK in complex with W3W5_BID
Published: 2022-01-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal Structure of human BAK in complex with W3W5_BID. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Jan 2022.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,586
Mol. weight: 21.39 kDa
Released: 12 Jan 2022

Explore 7M5A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M5A contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	23-48	26
α-helix	58-60	3
α-helix	71-81	11
α-helix	83-100	18
α-helix	107-120	14
α-helix	125-144	20
α-helix	151-164	14
α-helix	167-173	7
α-helix	177-182	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	81-100	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bcl-2 homologous antagonist/killer	A	protein	166	Homo sapiens	Q16611 (AlphaFold model)
BH3-interacting domain death agonist p15	B	protein	22	Homo sapiens	P55957 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7M5A_1 Bcl-2 homologous antagonist/killer (chains A)
SASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAI
IGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFESGINWGRVVALLGFGYRLAL
HVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAALNLCNG

Sequence of entity 2 (B), FASTA

>7M5A_2 BH3-interacting domain death agonist p15 (chains B)
EDIIRNIARHLAQWGDSMDRSW

Primary citation

Structural basis of BAK activation in mitochondrial apoptosis initiation. Singh, G., Guibao, C.D., Seetharaman, J. et al. Nat Commun (2022) 13:250-250. DOI 10.1038/s41467-021-27851-y · PubMed

Other PDB entries of the same protein (UniProt Q16611 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VX1 1.22 Å, Bak L100A
8CZF 1.3 Å, Human BAK in complex with the dF2 peptide
8CZH 1.3 Å, Human BAK in complex with the dM2 peptide
2IMS 1.48 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
2IMT 1.49 Å, The X-ray Structure of a Bak Homodimer Reveals an Inhibitory Zinc Binding Site
9CPE 1.49 Å, Structural basis of BAK sequestration by MCL-1 and consequences for apoptosis initiation
5FMI 1.49 Å, Human Bak Q77L
5VWY 1.55 Å, Bak core latch dimer in complex with Bim-h3Pc-RT
5VX0 1.6 Å, Bak in complex with Bim-h3Glg
5VWZ 1.62 Å, Bak in complex with Bim-h3Pc
6UXQ 1.7 Å, Crystal structure of BAK core domain BH3-groove-dimer in complex with POPC and C8E4
8IGC 1.7 Å, Crystal structure of Bak bound to Bnip5 BH3

Browse structure collections

About this viewer

MolViewer shows 7M5A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.