7M6Q: Glycine receptor subunit alphaZ1

Full length alpha1 Glycine receptor in presence of 1mM Glycine and 32uM Tetrahydrocannabinol State 1. Determined by electron microscopy at 2.91 Å resolution. Released 3 Aug 2022.

Method: Electron microscopy
Resolution: 2.91 Å
Organism: Danio rerio
Chains: 5
Atoms: 14,725
Mol. weight: 257.16 kDa
Ligands: TCI, NAG, GLY
Released: 3 Aug 2022

Explore 7M6Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M6Q contains 50 α-helices and 95 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	34-42	9
β-strand	63-73	11	1
β-strand	81-92	12	1
β-strand	93	1	2
β-strand	106-108	3	1
α-helix	119-121	3
β-strand	123-124	2	3
β-strand	127-131	5	1
β-strand	134-135	2	4
β-strand	137-138	2	4
β-strand	140-145	6	1
β-strand	149	1	2
β-strand	150-161	12	1
β-strand	173-181	9	3
β-strand	192-194	3	1
β-strand	200-202	3	1
β-strand	211-213	3	3
β-strand	219-220	2	3
β-strand	224-225	2	5
β-strand	230-231	2	5
β-strand	233-242	10	3
α-helix	246-247	2
α-helix	248-252	5
α-helix	253-268	16
α-helix	275-294	20
α-helix	299-300	2
α-helix	304-305	2
α-helix	306-340	35
α-helix	395-441	47

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycine receptor subunit alphaZ1	A, B, C, D, E	protein	444	Danio rerio	O93430 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>7M6Q_1 Glycine receptor subunit alphaZ1 (chains A, B, C, D, E)
MFALGIYLWETIVFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPP
VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKP
DLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQL
ESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHL
ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSF
AAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPL
VFLIFNIFYWITYKIIRSEDIHKQ

Ligands and cofactors

ID	Name	Formula	Copies
TCI	(6aR,10aR)-6,6,9-trimethyl-3-pentyl-6a,7,8,10a-tetrahydro-6H-benzo[c]chromen-1-…	C21 H30 O2	5
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5
GLY	Glycine	C2 H5 N O2	5

Primary citation

Structural basis for cannabinoid-induced potentiation of alpha1-glycine receptors in lipid nanodiscs. Kumar, A., Kindig, K., Rao, S. et al. Nat Commun (2022) 13:4862-4862. DOI 10.1038/s41467-022-32594-5 · PubMed

Other PDB entries of the same protein (UniProt O93430 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M6N 2.61 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine
7U2N 2.8 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6O 2.84 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine and 32uM…
6PLX 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLY 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, open state
6PM6 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Glycine in SMA, open…
6PXD 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor, Apo state
7U2M 2.9 Å, A novel compound mimics the structural and functional effects of the full agonist…
6PLS 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc,…
6PLW 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLZ 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, closed…
6PM1 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Taurine in SMA,…

Browse structure collections

About this viewer

MolViewer shows 7M6Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.