7U2M: Glycine receptor subunit alphaZ1

A novel compound mimics the structural and functional effects of the full agonist glycine on glycine channels-desenstized state. Determined by electron microscopy at 2.9 Å resolution. Released 8 Mar 2023.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Danio rerio
Chains: 5
Atoms: 14,155
Mol. weight: 266.18 kDa
Ligands: L2L
Released: 8 Mar 2023

Explore 7U2M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7U2M contains 50 α-helices and 80 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	26-34	9
α-helix	37-39	3
β-strand	53-65	13	1
β-strand	73-85	13	1
α-helix	87-89	3
β-strand	98-100	3	1
α-helix	103-106	4
β-strand	115-116	2	2
β-strand	122-123	2	1
β-strand	132-137	6	1
β-strand	141-153	13	1
β-strand	167-173	7	2
β-strand	182-186	5	1
β-strand	192-194	3	1
β-strand	203-205	3	3
β-strand	210-213	4	2
β-strand	216-217	2	4
β-strand	222-223	2	4
β-strand	225-231	7	2
β-strand	232-234	3	3
α-helix	237-239	3
α-helix	240-244	5
α-helix	245-255	11
α-helix	265-285	21
α-helix	298-326	29
α-helix	389-424	36

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycine receptor subunit alphaZ1	A, B, C, D, E	protein	458	Danio rerio	O93430 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>7U2M_1 Glycine receptor subunit alphaZ1 (chains A, B, C, D, E)
MFALGIYLWETIVFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPP
VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKP
DLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQL
ESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHL
ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSF
AAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPL
VFLIFNIFYWITYKIIRSEDIHKQLVPRGSHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
L2L	aminomethanesulfonic acid	C H5 N O3 S	5

Primary citation

A novel compound mimics the structural and functional effects of the full agonist glycine on glycine channels-desenstized state. Zhu, H., Gouaux, E. To be published.

Other PDB entries of the same protein (UniProt O93430 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M6N 2.61 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine
7U2N 2.8 Å, A novel compound mimics the structural and functional effects of the full agonist…
7M6O 2.84 Å, Full length alpha1 Glycine receptor in presence of 0.1mM Glycine and 32uM…
6PLX 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLY 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, open state
6PM6 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Glycine in SMA, open…
6PXD 2.9 Å, CryoEM structure of zebra fish alpha-1 glycine receptor, Apo state
7M6Q 2.91 Å, Full length alpha1 Glycine receptor in presence of 1mM Glycine and 32uM…
6PLS 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with taurine in nanodisc,…
6PLW 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA,…
6PLZ 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with GABA in SMA, closed…
6PM1 3.0 Å, CryoEM structure of zebra fish alpha-1 glycine receptor bound with Taurine in SMA,…

Browse structure collections

About this viewer

MolViewer shows 7U2M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.