Crystal structure of the F240 antibody fragment bound to the HIV-1 gp41 immunodominant region. Determined by X-ray diffraction at 1.7 Å resolution. Released 30 Mar 2022.
Explore 7N05 in 3D Show helices and sheets RCSB PDB PDBe
7N05 contains 19 α-helices and 45 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 597-599 | 3 | 2 |
| α-helix | 604-606 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 33-40 | 8 | 2 |
| β-strand | 44-51 | 8 | 2 |
| β-strand | 57-59 | 3 | 2 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 1 |
| β-strand | 77-82 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-100 | 13 | 2 |
| β-strand | 100C-103 | 9 | 2 |
| β-strand | 107-111 | 5 | 2 |
| α-helix | 114-116 | 3 | |
| β-strand | 117 | 1 | 3 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 4 |
| α-helix | 125-127 | 3 | |
| β-strand | 135-145 | 11 | 4 |
| β-strand | 146 | 1 | 3 |
| β-strand | 151-154 | 4 | 5 |
| α-helix | 155-157 | 3 | |
| β-strand | 163-165 | 3 | 4 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 4 |
| β-strand | 176-185 | 10 | 4 |
| α-helix | 186-188 | 3 | |
| β-strand | 195-200 | 6 | 5 |
| α-helix | 201-203 | 3 | |
| β-strand | 205-210 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 19-25 | 7 | 6 |
| β-strand | 27C-27D | 2 | 8 |
| β-strand | 30-31 | 2 | 8 |
| β-strand | 33-38 | 6 | 7 |
| β-strand | 45-49 | 5 | 7 |
| β-strand | 53-54 | 2 | 7 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 6 |
| β-strand | 70-75 | 6 | 6 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 7 |
| β-strand | 98 | 1 | 7 |
| β-strand | 102-106 | 5 | 7 |
| β-strand | 111 | 1 | 9 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 10 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 10 |
| β-strand | 140 | 1 | 9 |
| β-strand | 145-150 | 6 | 11 |
| β-strand | 153-154 | 2 | 11 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 10 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 10 |
| α-helix | 183-186 | 4 | |
| β-strand | 191-197 | 7 | 11 |
| β-strand | 205-210 | 6 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab F240 heavy chain | H | protein | 246 | Homo sapiens | |
| Fab F240 light chain | L | protein | 220 | Homo sapiens | |
| HIV-1 gp41 immunodominant region | E | protein | 16 | HIV-1 06TG.HT008 | P04578 (AlphaFold model) |
>7N05_1 Fab F240 heavy chain (chains H) QVQLVQSGGGVVKPGASLRLACSASGFTFTDYYMSWIRQTPGKGLQWLAYITKDGSEKKY ADSLQGRFAVSRDNANNLVFLQLNTVEDDDTGVYYCARDDGYYDRSGYYGVFDLWGQGIR VTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCGRLVPRGSHHHH HHHHHH
>7N05_2 Fab F240 light chain (chains L) EFLLTQSPDSLAVTLGETATITCRSSRNILHSLNNKNYLAWYQQRPGQAPKLLVIWASMR VSGVADRFSGSGSGTDFALTISSLQPEDAAVYYCQHYYTTHRTFGQGTRVEIRRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>7N05_3 HIV-1 gp41 immunodominant region (chains E) XWGSSGKLISTTAVPW
Conformational plasticity of the HIV-1 gp41 immunodominant region is recognized by multiple non-neutralizing antibodies. Cook, J.D., Khondker, A., Lee, J.E. Commun Biol (2022) 5:291-291. DOI 10.1038/s42003-022-03235-w · PubMed
Other PDB entries of the same protein (UniProt P04578 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7N05 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.