7N0A: Human Leukaemia Inhibitory Factor with Fab MSC1

Structure of Human Leukaemia Inhibitory Factor with Fab MSC1. Determined by X-ray diffraction at 3.1 Å resolution. Released 15 Jun 2022.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,755
Mol. weight: 69.32 kDa
Ligands: NAG
Released: 15 Jun 2022

Explore 7N0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7N0A contains 19 α-helices and 52 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
α-helix	12	1
β-strand	13-14	2	2
β-strand	19-21	3	1
β-strand	23-25	3	1
β-strand	30	1	3
β-strand	36	1	3
β-strand	38-43	6	4
α-helix	48-49	2
β-strand	50-54	5	4
β-strand	58-59	2	4
α-helix	60	1
β-strand	67-72	6	1
β-strand	75-80	6	1
β-strand	89-95	7	4
α-helix	102	1
β-strand	103	1	4
β-strand	105	1	1
β-strand	108-110	3	4
β-strand	112-113	2	2
β-strand	117	1	5
α-helix	118-119	2
β-strand	120-124	5	6
α-helix	125-127	3
β-strand	135-145	11	6
β-strand	146	1	5
β-strand	150-153	4	7
β-strand	155	1	8
β-strand	156	1	9
β-strand	160	1	8
β-strand	165-169	5	6
α-helix	170-173	4
β-strand	179-188	10	6
α-helix	189-192	4
β-strand	197-198	2	9
β-strand	201-204	4	7
β-strand	211-212	2	7
β-strand	215-216	2	9

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	10
β-strand	10-12	3	11
β-strand	17-25	9	10
α-helix	29-31	3
β-strand	34-39	6	11
β-strand	46-51	6	11
β-strand	60-62	3	11
β-strand	70-75	6	10
β-strand	80-86	7	10
α-helix	90-92	3
β-strand	94-101	8	11
β-strand	106-108	3	11
β-strand	112-116	5	11
α-helix	120-121	2
β-strand	122	1	12
β-strand	125-129	5	13
β-strand	140-150	11	13
β-strand	151	1	12
β-strand	155-159	5	14
α-helix	160-162	3
β-strand	164	1	14
β-strand	168-170	3	13
α-helix	171-173	3
β-strand	174-175	2	13
β-strand	181-190	10	13
α-helix	191-193	3
β-strand	199-205	7	14
β-strand	210-216	7	14

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	22-48	27
α-helix	67-69	3
α-helix	76-104	29
α-helix	109-137	29
α-helix	155-178	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukemia inhibitory factor	C	protein	181	Homo sapiens	P15018 (AlphaFold model)
MSC-1 Fab Light chain	A	protein	220	Homo sapiens
MSC-1 Fab Heavy chain	B	protein	224	Homo sapiens

Sequence of entity 1 (C), FASTA

>7N0A_1 Leukemia inhibitory factor (chains C)
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLC
GPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATAD
ILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
G

Sequence of entity 2 (A), FASTA

>7N0A_2 MSC-1 Fab Light chain (chains A)
DIVMTQTPLSSPVTLGQPASISCRSSQSLLDSDGHTYLNWLQQRPGQPPRLLIYSVSNLE
SGVPDRFSGSGAGTDFTLKISRVEAEDVGVYYCMQATHAPPYTFGQGTKLEIKRTVAAPS
VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (B), FASTA

>7N0A_3 MSC-1 Fab Heavy chain (chains B)
QVQLQESGGGLVKPGGSLRLSCAASGFTFSHAWMHWVRQAPGKGLEWVGQIKAKSDDYAT
YYAESVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTCWEWDLDFWGQGTMVTVSSAS
TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL
YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKT

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (GOL) are not listed.

Primary citation

Therapeutic Targeting of LIF Overcomes Macrophage-mediated Immunosuppression of the Local Tumor Microenvironment. Hallett, R.M., Bonfill-Teixidor, E., Iurlaro, R. et al. Clin Cancer Res (2023) 29:791-804. DOI 10.1158/1078-0432.CCR-21-1888 · PubMed

Other PDB entries of the same protein (UniProt P15018 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PVH 2.5 Å, Crystal structure of leukemia inhibitory factor in complex with gp130
1EMR 3.5 Å, Crystal structure of human leukemia inhibitory factor (LIF)
8D6A 3.54 Å, Cryo-EM structure of human LIF signaling complex: model containing the interaction core…
2Q7N 4.0 Å, Crystal structure of Leukemia inhibitory factor in complex with LIF receptor (domains 1-5)

Browse structure collections

About this viewer

MolViewer shows 7N0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.