7NDX: Human HSP40 DNAJB1-CTDs

Name: PDB 7NDX: Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC
Published: 2022-01-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

Crystal structure of the human HSP40 DNAJB1-CTDs in complex with a peptide of NudC. Determined by X-ray diffraction at 2.54 Å resolution. Released 19 Jan 2022.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,468
Mol. weight: 25.81 kDa
Released: 19 Jan 2022

Explore 7NDX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NDX contains 10 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	165-170	6	1
α-helix	172-177	6
β-strand	179-184	6	2
β-strand	203-208	6	2
α-helix	212-213	2
β-strand	217-219	3	1
β-strand	236-241	6	1
α-helix	242-243	2
β-strand	248-250	3	3
β-strand	253-261	9	3
α-helix	262-267	6
β-strand	269-274	6	4
α-helix	275	1
β-strand	280-285	6	4
β-strand	294-297	4	3
α-helix	302	1
β-strand	303-304	2	5
β-strand	307-311	5	5
β-strand	314-321	8	3
α-helix	322-323	2
α-helix	328-337	10

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	105-107	3	2
α-helix	109-123	15
α-helix	125-127	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DnaJ homolog subfamily B member 1	A	protein	184	Homo sapiens	P25685 (AlphaFold model)
Nuclear migration protein nudC	B	protein	42	Homo sapiens	Q9Y266 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7NDX_1 DnaJ homolog subfamily B member 1 (chains A)
RKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGT
KITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTL
DGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQ
VLPI

Sequence of entity 2 (B), FASTA

>7NDX_2 Nuclear migration protein nudC (chains B)
SGPQIKELTDEEAERLQLEIDQKKDAENHEAQLKNGSLDSPG

Primary citation

NudC guides client transfer between the Hsp40/70 and Hsp90 chaperone systems. Biebl, M.M., Delhommel, F., Faust, O. et al. Mol Cell (2022) 82:555. DOI 10.1016/j.molcel.2021.12.031 · PubMed

Other PDB entries of the same protein (UniProt P25685 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AGX 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain
3AGY 1.85 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
4WB7 1.9 Å, Crystal structure of a chimeric fusion of human DnaJ (Hsp40) and cAMP-dependent protein…
8FE2 2.34 Å, Structure of J-PKAc chimera complexed with Aplithianine A
9NFS 2.45 Å, Structure of J-PKAc chimera in complex with Aplithianine j1
3AGZ 2.51 Å, Crystal structure of human Hsp40 Hdj1 peptide-binding domain complexed with a C-terminal…
8FE5 2.51 Å, Structure of J-PKAc chimera complexed with Aplithianine B
2QLD 2.7 Å, human Hsp40 Hdj1
8FEC 2.7 Å, Structure of J-PKAc chimera complexed with Aplithianine derivative
6BYR 3.66 Å, Structures of the PKA RI alpha holoenzyme with the FLHCC driver J-PKAc alpha or native…
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 7NDX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.