Crystal structure of pseudokinase CASK in complex with PFE-PKIS12. Determined by X-ray diffraction at 2.3 Å resolution. Released 19 May 2021.
Explore 7OAI in 3D Show helices and sheets RCSB PDB PDBe
7OAI contains 76 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-11 | 4 | |
| β-strand | 12-20 | 9 | 1 |
| β-strand | 24-31 | 8 | 1 |
| β-strand | 37-44 | 8 | 1 |
| α-helix | 45-49 | 5 | |
| α-helix | 56-68 | 13 | |
| β-strand | 74 | 1 | 2 |
| α-helix | 75-76 | 2 | |
| β-strand | 77-83 | 7 | 1 |
| β-strand | 86-92 | 7 | 1 |
| β-strand | 98 | 1 | 2 |
| α-helix | 99-108 | 10 | |
| α-helix | 115-134 | 20 | |
| β-strand | 137-138 | 2 | 3 |
| α-helix | 144-146 | 3 | |
| β-strand | 147-149 | 3 | 2 |
| α-helix | 156-157 | 2 | |
| β-strand | 158-160 | 3 | 2 |
| β-strand | 167-168 | 2 | 3 |
| β-strand | 175 | 1 | 4 |
| α-helix | 183-185 | 3 | |
| α-helix | 188-191 | 4 | |
| β-strand | 196 | 1 | 4 |
| α-helix | 199-214 | 16 | |
| α-helix | 223-232 | 10 | |
| α-helix | 239-242 | 4 | |
| α-helix | 247-256 | 10 | |
| α-helix | 265-266 | 2 | |
| α-helix | 267-272 | 6 | |
| α-helix | 274-277 | 4 | |
| α-helix | 279-282 | 4 | |
| α-helix | 289-302 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-11 | 4 | |
| β-strand | 12-21 | 10 | 5 |
| β-strand | 24-31 | 8 | 5 |
| β-strand | 37-44 | 8 | 5 |
| α-helix | 45-49 | 5 | |
| α-helix | 56-68 | 13 | |
| β-strand | 74 | 1 | 6 |
| α-helix | 75-76 | 2 | |
| β-strand | 77-83 | 7 | 5 |
| β-strand | 86-92 | 7 | 5 |
| β-strand | 98 | 1 | 6 |
| α-helix | 99-108 | 10 | |
| α-helix | 115-134 | 20 | |
| β-strand | 137-138 | 2 | 7 |
| α-helix | 144-146 | 3 | |
| β-strand | 147-149 | 3 | 6 |
| α-helix | 156-157 | 2 | |
| β-strand | 158-160 | 3 | 6 |
| β-strand | 167-168 | 2 | 7 |
| β-strand | 175 | 1 | 8 |
| α-helix | 183-185 | 3 | |
| α-helix | 188-191 | 4 | |
| β-strand | 196 | 1 | 8 |
| α-helix | 199-214 | 16 | |
| α-helix | 223-232 | 10 | |
| α-helix | 239-242 | 4 | |
| α-helix | 247-256 | 10 | |
| α-helix | 265-266 | 2 | |
| α-helix | 267-272 | 6 | |
| α-helix | 274-277 | 4 | |
| α-helix | 279-282 | 4 | |
| α-helix | 289-302 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peripheral plasma membrane protein CASK | A, B, C, D | protein | 353 | Homo sapiens | O14936 (AlphaFold model) |
>7OAI_1 Peripheral plasma membrane protein CASK (chains A, B, C, D) SMGSPGISGGGGGIRTMADDDVLFEDVYELCEVIGKGPFSVVRRCINRETGQQFAVKIVD VAKFTSSPGLSTEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIV KRADAGFVYSEAVASHYMRQILEALRYCHDNNIIHRDVKPHCVLLASKENSAPVKLGGFG VAIQLGESGLVAGGRVGTPHFMAPEVVKREPYGKPVDVWGCGVILFILLSGCLPFYGTKE RLFEGIIKGKYKMNPRQWSHISESAKDLVRRMLMLDPAERITVYEALNHPWLKERDRYAY KIHLPETVEQLRKFNARRKLKGAVLAAVSSHKFNSFYGDPPEELPDFSEDPTS
| ID | Name | Formula | Copies |
|---|---|---|---|
| V5W | 4-(Cyclopentylamino)-2-[(2,5-dichlorophenyl)methylamino]-N-[3-(2-oxo-1,3-oxazol… | C23 H28 Cl2 N6 O3 | 4 |
Water and common crystallization additives (EDO) are not listed.
Design and Development of a Chemical Probe for Pseudokinase Ca 2+ /calmodulin-Dependent Ser/Thr Kinase. Russ, N., Schroder, M., Berger, B.T. et al. J Med Chem (2021) 64:14358-14376. DOI 10.1021/acs.jmedchem.1c00845 · PubMed
Other PDB entries of the same protein (UniProt O14936 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7OAI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.