7OW1: TAP01

Crystal Structure of TAP01 in complex with amyloid beta peptide. Determined by X-ray diffraction at 1.4 Å resolution. Released 29 Jun 2022.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,896
Mol. weight: 48.45 kDa
Ligands: FLC
Released: 29 Jun 2022

Explore 7OW1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7OW1 contains 20 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	11	1	1

Chain H: 11 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	11-12	2	3
β-strand	18-25	8	2
β-strand	33-39	7	4
β-strand	45-51	7	4
β-strand	57-59	3	4
α-helix	61-63	3
β-strand	67-72	6	2
α-helix	73-75	3
β-strand	77-82	6	2
α-helix	87-89	3
β-strand	91-98	8	4
β-strand	103-106	4	4
β-strand	110-112	3	4
β-strand	113-114	2	3
α-helix	117-119	3
β-strand	120	1	5
α-helix	121-122	2
β-strand	123-127	5	6
α-helix	128-130	3
α-helix	133-134	2
β-strand	138-148	11	6
β-strand	149	1	5
β-strand	154-157	4	7
α-helix	158-160	3
β-strand	162	1	7
β-strand	166-168	3	6
α-helix	169-171	3
β-strand	172-173	2	6
β-strand	179-188	10	6
α-helix	189-191	3
β-strand	198-203	6	7
α-helix	204-206	3
β-strand	208-213	6	7

Chain K: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	8
β-strand	10-13	4	9
β-strand	19-25	7	8
β-strand	33-38	6	9
β-strand	44-49	6	9
β-strand	53-54	2	9
α-helix	55	1
β-strand	62-67	6	8
β-strand	70-75	6	8
α-helix	80-82	3
β-strand	85-90	6	9
α-helix	96	1
β-strand	97-98	2	9
β-strand	102-106	5	9
β-strand	111	1	10
α-helix	112-113	2
β-strand	114-118	5	11
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	11
β-strand	140	1	10
β-strand	145-150	6	12
β-strand	153	1	12
β-strand	159-163	5	11
α-helix	164-167	4
β-strand	173-182	10	11
α-helix	183-186	4
β-strand	191-197	7	12
β-strand	205-210	6	12
α-helix	211-213	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid-beta precursor protein	A	protein	12	Homo sapiens	P05067 (AlphaFold model)
TAP01 family antibody heavy chain	H	protein	219	Homo sapiens
TAP01 family antibody light chain	K	protein	214	Homo sapiens

Sequence of entity 1 (A), FASTA

>7OW1_1 Amyloid-beta precursor protein (chains A)
QFRHDSGYEVHH

Sequence of entity 2 (H), FASTA

>7OW1_2 TAP01 family antibody heavy chain (chains H)
QVQLKQSGPGLVQPSQSLSITCTVSGFSLTSYGIHWVRQSPGKGLEWLGVMWSGGITDFY
AAFISRLSISRDISKSQVFFKMNSLQADDTAIYYCARGSRYALDYWGQGTSVSVSSASTK
GPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYS
LSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC

Sequence of entity 3 (K), FASTA

>7OW1_3 TAP01 family antibody light chain (chains K)
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTVKLLIYYTSRLHSGVPS
RFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPPTFGGGTKLEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Ligands and cofactors

ID	Name	Formula	Copies
FLC	Citrate anion	C6 H5 O7	1

Primary citation

Discovery of a novel pseudo beta-hairpin structure of N-truncated amyloid-beta for use as a vaccine against Alzheimer's disease. Bakrania, P., Hall, G., Bouter, Y. et al. Mol Psychiatry (2022) 27:840-848. DOI 10.1038/s41380-021-01385-7 · PubMed

Other PDB entries of the same protein (UniProt P05067 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FMA 0.85 Å, Structure of the Alzheimer's Amyloid Precursor Protein (APP) Copper Binding Domain in…
6NB9 1.05 Å, Amyloid-Beta (20-34) with L-isoaspartate 23
6OIZ 1.1 Å, Amyloid-Beta (20-34) wild type
8T82 1.1 Å, Racemic mixture of amyloid beta segment 35-MVGGVV-40 forms heterochiral rippled…
5ONQ 1.17 Å, Alzheimer's Amyloid-Beta Peptide Fragment 29-40 in Complex with Cd-substituted Thermolysin
3JQL 1.2 Å, Crystal Structure of the Complex Formed Between Phospholipase A2 and a Hexapeptide…
3PZZ 1.29 Å, Structure of an amyloid forming peptide GAIIGL (29-34) from amyloid beta
4PQD 1.33 Å, The longer crystal structure of the grow factor like domain from Beta amypoid precusor…
5ONP 1.34 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Cd-substituted Thermolysin
5ONR 1.39 Å, Alzheimer's Amyloid-Beta Peptide Fragment 1-40 in Complex with Thermolysin
4PWQ 1.4 Å, High-resolution crystal structure of the E1-domain of the amyloid precursor protein
6O4J 1.4 Å, Amyloid Beta KLVFFAENVGS 16-26 D23N Iowa mutation

Browse structure collections

About this viewer

MolViewer shows 7OW1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.