7P93: Leukotoxin LukE from Staphylococcus aureus

Name: PDB 7P93: Crystal Structure of leukotoxin LukE from Staphylococcus aureus in complex with a sulfated ACKR1 N-terminal peptide
Published: 2022-04-06
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal Structure of leukotoxin LukE from Staphylococcus aureus in complex with a sulfated ACKR1 N-terminal peptide. Determined by X-ray diffraction at 1.55 Å resolution. Released 6 Apr 2022.

Method: X-ray diffraction
Resolution: 1.55 Å
Organisms: Staphylococcus aureus, Homo sapiens
Chains: 3
Atoms: 2,631
Mol. weight: 37.7 kDa
Released: 6 Apr 2022

Explore 7P93 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7P93 contains 5 α-helices and 25 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	31-36	6	1
β-strand	39-50	12	1
β-strand	55-65	11	1
β-strand	71-83	13	1
β-strand	87-90	4	2
β-strand	91	1	3
β-strand	99-113	15	2
β-strand	120-125	6	1
β-strand	130	1	2
β-strand	134-142	9	4
β-strand	146-150	5	4
β-strand	161-168	8	4
β-strand	172-179	8	2
β-strand	183-190	8	2
β-strand	192-195	4	5
β-strand	198-201	4	5
β-strand	209	1	6
α-helix	219-222	4
β-strand	223	1	6
α-helix	226-228	3
α-helix	231-234	4
β-strand	236-237	2	1
β-strand	241-248	8	1
β-strand	254-273	20	2
β-strand	277-299	23	2
β-strand	304-307	4	2

Chain B: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	41	1	3
α-helix	43-44	2
β-strand	45	1	2

Chain M: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leucotoxin LukEv	A	protein	308	Staphylococcus aureus	Q2FXB0 (AlphaFold model)
Atypical chemokine receptor 1	B, M	protein	14	Homo sapiens	Q16570 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7P93_1 Leucotoxin LukEv (chains A)
MSVGLIAPLASPIQESRANTNIENIGDGAEVIKRTEDVSSKKWGVTQNVQFDFVKDKKYN
KDALIVKMQGFINSRTSFSDVKGSGYELTKRMIWPFQYNIGLTTKDPNVSLINYLPKNKI
ETTDVGQTLGYNIGGNFQSAPSIGGNGSFNYSKTISYTQKSYVSEVDKQNSKSVKWGVKA
NEFVTPDGKKSAHDRYLFVQSPNGPTGSAREYFAPDNQLPPLVQSGFNPSFITTLSHEKG
SSDTSEFEISYGRNLDITYATLFPRTGIYAERKHNAFVNRNFVVRYEVNWKTHEIKVKGH
NKHHHHHH

Sequence of entity 2 (B, M), FASTA

>7P93_2 Atypical chemokine receptor 1 (chains B, M)
XDSFPDGDYGANLE

Primary citation

Structural insights into recognition of chemokine receptors by Staphylococcus aureus leukotoxins. Lambey, P., Otun, O., Cong, X. et al. Elife (2022) 11. DOI 10.7554/eLife.72555 · PubMed

Other PDB entries of the same protein (UniProt Q2FXB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7P8X 1.4 Å, Crystal Structure of leukotoxin LukE from Staphylococcus aureus in complex with a doubly…
7P8T 1.46 Å, Crystal Structure of leukotoxin LukE from Staphylococcus aureus at 1.5 Angstrom resolution
7P8U 1.6 Å, Crystal Structure of leukotoxin LukE from Staphylococcus aureus in complex with p-cresyl…
7P8S 1.9 Å, Crystal Structure of leukotoxin LukE from Staphylococcus aureus at 1.9 Angstrom resolution
3ROH 3.2 Å, Crystal Structure of Leukotoxin (LukE) from Staphylococcus aureus subsp. aureus COL.
7T82 3.5 Å, Crystal Structure of LEUKOCIDIN E/CENTYRIN S26/FAB B438

Browse structure collections

About this viewer

MolViewer shows 7P93 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.