7PC3: The second PDZ domain of DLG1

The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1. Determined by X-ray diffraction at 1.95 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 1.95 Å
Organisms: Homo sapiens, HTLV-1 subtype A
Chains: 2
Atoms: 3,721
Mol. weight: 48.86 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7PC3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PC3 contains 24 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	315-316	2
β-strand	317-323	7	1
β-strand	325	1	2
β-strand	328	1	2
β-strand	331-335	5	1
β-strand	337	1	3
β-strand	342	1	4
β-strand	345	1	4
β-strand	348-353	6	1
α-helix	358-362	5
β-strand	370-374	5	1
β-strand	377-378	2	1
β-strand	383	1	3
α-helix	384-392	9
β-strand	397-403	7	1
α-helix	418-433	16
α-helix	439-446	8
α-helix	451-465	15
α-helix	469-476	8
α-helix	479-488	10
α-helix	492-503	12
α-helix	511-520	10
α-helix	523-537	15
α-helix	541-548	8
α-helix	551-561	11
α-helix	565-567	3
α-helix	574-587	14
α-helix	596-605	10
α-helix	608-621	14
α-helix	626-633	8
α-helix	636-650	15
α-helix	652-664	13
α-helix	671-681	11
α-helix	686-697	12
α-helix	701-708	8
α-helix	711-721	11

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	204-205	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Disks large homolog 1,Annexin A2	A	protein	417	Homo sapiens	P07355 (AlphaFold model), Q12959 (AlphaFold model)
Protein Tax-1	C	protein	10	HTLV-1 subtype A	P03409

Sequence of entity 1 (A), FASTA

>7PC3_1 Disks large homolog 1,Annexin A2 (chains A)
GSHMGSEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIG
DKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGSAYTNFDAERDALNI
ETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGL
LKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISD
TSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSV
PHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKG
TRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (C), FASTA

>7PC3_2 Protein Tax-1 (chains C)
SEKHFRETEV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (SO4, GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
2HYW 2.1 Å, Human Annexin A2 with Calcium bound

Browse structure collections

About this viewer

MolViewer shows 7PC3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.