7PC5: The third PDZ domain of PDZD7

The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4. Determined by X-ray diffraction at 1.7 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,882
Mol. weight: 48.79 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7PC5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PC5 contains 23 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	860-865	6	1
β-strand	874-877	4	1
β-strand	889-893	5	1
α-helix	898-902	5
β-strand	910-914	5	1
β-strand	917-918	2	1
α-helix	924-936	13
β-strand	943-948	6	1
α-helix	965-980	16
α-helix	986-993	8
α-helix	998-1012	15
α-helix	1016-1023	8
α-helix	1026-1036	11
α-helix	1039-1050	12
α-helix	1058-1067	10
α-helix	1070-1084	15
α-helix	1088-1095	8
α-helix	1098-1108	11
α-helix	1112-1116	5
α-helix	1121-1134	14
α-helix	1143-1152	10
α-helix	1155-1168	14
α-helix	1173-1180	8
α-helix	1183-1197	15
α-helix	1199-1211	13
α-helix	1218-1228	11
α-helix	1233-1244	12
α-helix	1248-1255	8
α-helix	1258-1268	11

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	33-35	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PDZ domain-containing protein 7,Annexin A2	A	protein	420	Homo sapiens	P07355 (AlphaFold model), Q9H5P4 (AlphaFold model)
Exocyst complex component 4	B	protein	10	Homo sapiens	Q96A65 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PC5_1 PDZ domain-containing protein 7,Annexin A2 (chains A)
GSHMGGELKTVTLSKMKQSLGISISGGIESKVQPMVKIEKIFPGGAAFLSGALQAGFELV
AVDGENLEQVTHQRAVDTIRRAYRNKAREPMELVVRVPGPSGSAYGSVKAYTNFDAERDA
LNIETAIKTKGVDEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVI
LGLLKTPAQYDASELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDI
ISDTSGDFRKLMVALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTE
RSVPHLQKVFDRYKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMK
GKGTRDKVLIRIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (B), FASTA

>7PC5_2 Exocyst complex component 4 (chains B)
ATKDKKITTV

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Water and common crystallization additives (GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2
2HYW 2.1 Å, Human Annexin A2 with Calcium bound

Browse structure collections

About this viewer

MolViewer shows 7PC5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.