7PGK: Hedgehog-interacting protein

HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), in complex with glycosaminoglycan mimic SOS. Determined by X-ray diffraction at 2.75 Å resolution. Released 15 Dec 2021.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,019
Mol. weight: 22.07 kDa
Released: 15 Dec 2021

Explore 7PGK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PGK contains 8 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	44-45	2
β-strand	46-47	2	1
α-helix	50-57	8
β-strand	76-77	2	1
α-helix	102-111	10
α-helix	112-114	3
α-helix	119-123	5
β-strand	140-141	2	2
α-helix	142-151	10
α-helix	157-159	3
α-helix	164-171	8
β-strand	172-173	2	2
β-strand	180	1	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hedgehog-interacting protein	A	protein	183	Homo sapiens	Q96QV1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7PGK_1 Hedgehog-interacting protein (chains A)
ETGCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIF
SVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGH
IPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISGTKHHH
HHH

Primary citation

Hedgehog-Interacting Protein is a multimodal antagonist of Hedgehog signalling. Griffiths, S.C., Schwab, R.A., El Omari, K. et al. Nat Commun (2021) 12:7171-7171. DOI 10.1038/s41467-021-27475-2 · PubMed

Other PDB entries of the same protein (UniProt Q96QV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7PGN 2.4 Å, HHP-C in complex with glycosaminoglycan mimic SOS
2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
7PGL 2.63 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), apo-form
7PGM 2.7 Å, HHIP-C in complex with heparin
2WFT 2.8 Å, Crystal structure of the human HIP ectodomain
3HO3 2.9 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
3HO5 3.01 Å, Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex
3HO4 3.1 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 7PGK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.