7PGN: HHP-C

HHP-C in complex with glycosaminoglycan mimic SOS. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 Dec 2021.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,108
Mol. weight: 109.11 kDa
Ligands: CA
Released: 15 Dec 2021

Explore 7PGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7PGN contains 29 α-helices and 86 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	217	1	1
β-strand	218-226	9	2
β-strand	229-233	5	2
β-strand	242-246	5	2
β-strand	250-254	5	2
α-helix	259	1
β-strand	260	1	2
α-helix	261	1
β-strand	266-267	2	2
β-strand	284-289	6	3
α-helix	293-296	4
β-strand	298-305	8	3
β-strand	317-326	10	3
β-strand	334-347	14	3
β-strand	354-359	6	4
α-helix	364	1
β-strand	365-369	5	4
α-helix	376-381	6
β-strand	391-395	5	4
β-strand	396	1	5
β-strand	407	1	5
β-strand	424-427	4	4
β-strand	432	1	6
β-strand	434	1	7
α-helix	435	1
β-strand	436-438	3	6
β-strand	449-455	7	6
β-strand	463-468	6	6
β-strand	473	1	4
α-helix	477-479	3
β-strand	491-496	6	7
β-strand	509-513	5	7
β-strand	518-523	6	7
β-strand	530-535	6	7
β-strand	537	1	1
β-strand	540	1	8
β-strand	543	1	8
β-strand	544	1	2
β-strand	550-556	7	2
β-strand	562-567	6	2
β-strand	577-583	7	2
β-strand	588	1	9
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	10
β-strand	623-625	3	10
α-helix	626	1
β-strand	629-630	2	11
β-strand	636-637	2	11
α-helix	638	1
α-helix	642-643	2
β-strand	648-651	4	12
β-strand	654-656	3	12
α-helix	657-658	2
β-strand	661-662	2	13
β-strand	668-669	2	13

Chain B: 16 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	217	1	14
β-strand	218-226	9	15
β-strand	229-233	5	15
β-strand	242-246	5	15
β-strand	250-254	5	15
α-helix	259	1
β-strand	260	1	15
α-helix	261	1
β-strand	266-267	2	15
β-strand	284-289	6	16
α-helix	293-296	4
β-strand	298-305	8	16
β-strand	317-326	10	16
β-strand	334-347	14	16
β-strand	354-359	6	17
α-helix	364	1
β-strand	365-369	5	17
α-helix	376-381	6
β-strand	391-395	5	17
β-strand	396	1	18
β-strand	407	1	18
β-strand	424-427	4	17
β-strand	432	1	19
β-strand	434	1	20
α-helix	435	1
β-strand	436-437	2	19
β-strand	450-454	5	19
β-strand	464-468	5	19
β-strand	473	1	17
α-helix	477-479	3
α-helix	484-486	3
β-strand	491-496	6	20
β-strand	509-513	5	20
β-strand	518-523	6	20
β-strand	530-535	6	20
β-strand	537	1	14
β-strand	540	1	21
β-strand	543	1	21
β-strand	544	1	15
β-strand	550-556	7	15
β-strand	562-567	6	15
α-helix	569-573	5
β-strand	577-583	7	15
β-strand	588	1	9
α-helix	592-594	3
α-helix	607-611	5
β-strand	615-617	3	22
α-helix	622	1
β-strand	623-625	3	22
α-helix	626	1
β-strand	629-630	2	23
β-strand	636-637	2	23
α-helix	638	1
α-helix	642-643	2
β-strand	648-651	4	24
β-strand	654-656	3	24
α-helix	657-658	2
β-strand	661-662	2	25
β-strand	668-669	2	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Hedgehog-interacting protein	A, B	protein	470	Homo sapiens	Q96QV1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7PGN_1 Hedgehog-interacting protein (chains A, B)
ETGKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIH
KLVQSGIKGGDERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRK
NPHQVDLRTARVFLEVAELHRKHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFT
GSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQPPEVFAHGLHDPGRCAVDRHPTDININLT
ILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGPLVGGFVYRGCQSERLYGSY
VFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELGEVYILSSSK
SMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGW
EGDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

Hedgehog-Interacting Protein is a multimodal antagonist of Hedgehog signalling. Griffiths, S.C., Schwab, R.A., El Omari, K. et al. Nat Commun (2021) 12:7171-7171. DOI 10.1038/s41467-021-27475-2 · PubMed

Other PDB entries of the same protein (UniProt Q96QV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2WG3 2.6 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
7PGL 2.63 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), apo-form
7PGM 2.7 Å, HHIP-C in complex with heparin
7PGK 2.75 Å, HHIP-N, the N-terminal domain of the Hedgehog-Interacting Protein (HHIP), in complex…
2WFT 2.8 Å, Crystal structure of the human HIP ectodomain
3HO3 2.9 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
3HO5 3.01 Å, Crystal structure of Hedgehog-interacting protein (HHIP) and Sonic hedgehog (SHH) complex
3HO4 3.1 Å, Crystal structure of Hedgehog-interacting protein (HHIP)
2WG4 3.15 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…
2WFX 3.2 Å, Crystal structure of the complex between human hedgehog-interacting protein HIP and…

Browse structure collections

About this viewer

MolViewer shows 7PGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.