Crystal structure of the Burkholderia Lethal Factor 1 (BLF1) C94S inactive mutant in complex with human eIF4A - Crystal form B. Determined by X-ray diffraction at 3.0 Å resolution. Released 13 Apr 2022.
Explore 7PQ0 in 3D Show helices and sheets RCSB PDB PDBe
7PQ0 contains 29 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-15 | 11 | |
| β-strand | 20-23 | 4 | 1 |
| α-helix | 25-29 | 5 | |
| α-helix | 31 | 1 | |
| β-strand | 33-41 | 9 | 1 |
| β-strand | 45-49 | 5 | 1 |
| β-strand | 57-64 | 8 | 1 |
| β-strand | 71-74 | 4 | 2 |
| α-helix | 76-78 | 3 | |
| β-strand | 85-88 | 4 | 1 |
| β-strand | 91 | 1 | 1 |
| β-strand | 95-99 | 5 | 2 |
| β-strand | 104-107 | 4 | 2 |
| α-helix | 113-120 | 8 | |
| α-helix | 124-127 | 4 | |
| β-strand | 134-142 | 9 | 2 |
| α-helix | 147-149 | 3 | |
| β-strand | 156-158 | 3 | 2 |
| α-helix | 160-161 | 2 | |
| β-strand | 162-164 | 3 | 2 |
| β-strand | 171-180 | 10 | 1 |
| β-strand | 183-192 | 10 | 1 |
| β-strand | 195-196 | 2 | 1 |
| β-strand | 200-201 | 2 | 1 |
| β-strand | 205-209 | 5 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-25 | 4 | 3 |
| α-helix | 34-36 | 3 | |
| α-helix | 41-49 | 9 | |
| α-helix | 57-67 | 11 | |
| β-strand | 72-74 | 3 | 3 |
| α-helix | 80-93 | 14 | |
| β-strand | 103-106 | 4 | 3 |
| α-helix | 110-124 | 15 | |
| β-strand | 131-134 | 4 | 3 |
| α-helix | 137-139 | 3 | |
| α-helix | 144-147 | 4 | |
| β-strand | 154-157 | 4 | 3 |
| α-helix | 159-167 | 9 | |
| β-strand | 178-182 | 5 | 3 |
| α-helix | 184-189 | 6 | |
| α-helix | 193-201 | 9 | |
| β-strand | 208-212 | 5 | 3 |
| α-helix | 218-227 | 10 | |
| α-helix | 231 | 1 | |
| β-strand | 232-237 | 6 | 3 |
| β-strand | 242 | 1 | 4 |
| β-strand | 246-254 | 9 | 5 |
| α-helix | 256-258 | 3 | |
| α-helix | 259-269 | 11 | |
| β-strand | 275-279 | 5 | 5 |
| α-helix | 282-294 | 13 | |
| β-strand | 299-301 | 3 | 5 |
| α-helix | 308-320 | 13 | |
| β-strand | 325-329 | 5 | 5 |
| α-helix | 335-336 | 2 | |
| β-strand | 343-346 | 4 | 5 |
| α-helix | 353-360 | 8 | |
| β-strand | 362 | 1 | 4 |
| β-strand | 370-377 | 8 | 5 |
| α-helix | 378-382 | 5 | |
| α-helix | 387-391 | 5 | |
| β-strand | 396-397 | 2 | 5 |
| α-helix | 398 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Burkholderia Lethal Factor 1 (BLF1) | A | protein | 211 | Burkholderia pseudomallei (strain K96243) | Q63UP7 (AlphaFold model) |
| Eukaryotic initiation factor 4A-I | B | protein | 394 | Homo sapiens | P60842 (AlphaFold model) |
>7PQ0_1 Burkholderia Lethal Factor 1 (BLF1) (chains A) MPNSLEAQIRQAMKTGSTLTIEFDQALNQKSPGTLNVFLHPANGGVRIDLDSGNQGEPAK ILWLPWKQGELQTLQPGSISTVDMLFFTYYLSGSKVFAGDGGPVWHIDAPVEANQFWRRM SSDEWMEDWEVGTDRQVAYLHRAGQSDSLWNLSAYLEGAAPSTYGRDNLGQAVVGGIVTG RQQMSLYQYATTSSGSSAWSPLTYTLQQRKQ
>7PQ0_2 Eukaryotic initiation factor 4A-I (chains B) MHHHHHHEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDV IAQAQSGTGKTATFAISILQQIELDLKATQALVLAPTRELAQQIQKVVMALGDYMGASCH ACIGGTNVRAEVQKLQMEAPHIIVGTPGRVFDMLNRRYLSPKYIKMFVLDEADEMLSRGF KDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYIN VEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHARDFTVSAMHGDMDQKERD VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGRGGRFGRKGVA INMVTEEDKRTLRDIETFYNTSIEEMPLNVADLI
Molecular basis of specificity and deamidation of eIF4A by Burkholderia Lethal Factor 1. Mobbs, G.W., Aziz, A.A., Dix, S.R. et al. Commun Biol (2022) 5:272-272. DOI 10.1038/s42003-022-03186-2 · PubMed
Other PDB entries of the same protein (UniProt Q63UP7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7PQ0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.