7Q8A: Poly-binding-splicing factor PUF60

Crystal structure of tandem domain RRM1-2 of FUBP-interacting repressor (FIR) bound to FUSE ssDNA fragment. Determined by X-ray diffraction at 2.05 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,174
Mol. weight: 45.49 kDa
Released: 9 Nov 2022

Explore 7Q8A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Q8A contains 19 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	98-111	14
β-strand	113-117	5	1
α-helix	125-132	8
α-helix	133-135	3
β-strand	138-143	6	1
β-strand	146	1	2
β-strand	151	1	2
β-strand	156-160	5	1
α-helix	163-172	10
β-strand	177-178	2	3
β-strand	181-182	2	3
β-strand	184-186	3	1
α-helix	195-205	11
α-helix	206-208	3
β-strand	210-214	5	4
α-helix	222-229	8
α-helix	230-232	3
β-strand	235-242	8	4
β-strand	249-257	9	4
α-helix	260-270	11
β-strand	274-275	2	5
β-strand	278-279	2	5
β-strand	281-284	4	4

Chain B: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	97-111	15
β-strand	113-117	5	6
α-helix	125-132	8
α-helix	133-135	3
β-strand	138-143	6	6
β-strand	146	1	7
β-strand	151	1	7
β-strand	156-160	5	6
α-helix	163-173	11
β-strand	177-178	2	8
β-strand	181-182	2	8
α-helix	183	1
β-strand	184-186	3	6
α-helix	191-194	4
α-helix	197-205	9
β-strand	209-214	6	9
α-helix	222-229	8
α-helix	230-232	3
β-strand	235-242	8	9
β-strand	249-257	9	9
α-helix	260-270	11
β-strand	274-275	2	10
β-strand	278-279	2	10
β-strand	281-284	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly(U)-binding-splicing factor PUF60	A, B	protein	199	Homo sapiens	Q9UHX1 (AlphaFold model)
DNA (5'-d(pgpt)-3')	D	DNA	2	Homo sapiens
ssDNA	E	DNA	2	Homo sapiens

Sequence of entity 1 (A, B), FASTA

>7Q8A_1 Poly(U)-binding-splicing factor PUF60 (chains A, B)
SMLQSMAAQRQRALAIMCRVYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKG
FAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVA
SVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQSSQDAVSSMNLFD
LGGQYLRVGKAVTPPMPLL

Sequence of entity 2 (D), FASTA

>7Q8A_2 DNA (5'-D(P*GP*T)-3') (chains D)
GT

Sequence of entity 3 (E), FASTA

>7Q8A_3 ssDNA (chains E)
TT

Primary citation

Crystal structure of tandem domain RRM1-2 of FIR bound to FUSE ssDNA fragment. Ni, X., Joerger, A.C., Chaikuad, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UHX1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3UE2 1.23 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
3US5 1.38 Å, Crystal structure of a RNA-binding domain of a poly-U binding splicing factor 60KDa…
7Z3X 1.65 Å, Crystal structure of FIR RRM1-2 Y115F mutant bound to FUSE ssDNA
5KW6 1.91 Å, Two Tandem RRM Domains of PUF60 Bound to an AdML Pre-mRNA 3' Splice Site Analogue with a…
5KVY 1.95 Å, Crystal structure of the two tandem rrm domains of PUF60 bound to a portion of an adml…
6LUR 2.0 Å, Human PUF60 UHM domain (thioredoxin fusion) in complex with a small molecule binder
2QFJ 2.1 Å, Crystal Structure of First Two RRM Domains of FIR Bound to ssDNA from a Portion of FUSE
5KW1 2.1 Å, Crystal Structure of the Two Tandem RRM Domains of PUF60 Bound to a Modified AdML…
3DXB 2.2 Å, Structure of the UHM domain of Puf60 fused to thioredoxin
3UWT 2.5 Å, Crystal structure of a RNA binding domain of poly-U binding splicing factor 60KDa…
5KWQ 2.8 Å, Two Tandem RRM Domains of FBP-Interacting Repressor (FIR), also Known as PUF60
2DNY Solution structure of the third RNA binding domain of FBP-interacting repressor, SIAHBP1

Browse structure collections

About this viewer

MolViewer shows 7Q8A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.