7QQL: The PDZ domain of SNTG2

The PDZ domain of SNTG2 complexed with the phosphorylated PDZ-binding motif of RSK1. Determined by X-ray diffraction at 2.44 Å resolution. Released 20 Apr 2022.

Method: X-ray diffraction
Resolution: 2.44 Å
Organism: Homo sapiens
Chains: 6
Atoms: 9,838
Mol. weight: 143.48 kDa
Ligands: CA
Released: 20 Apr 2022

Explore 7QQL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7QQL contains 72 α-helices and 27 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	71-77	7	3
β-strand	79	1	4
β-strand	83	1	4
β-strand	87-89	3	3
β-strand	99-102	4	3
α-helix	108-111	4
β-strand	119-124	6	3
β-strand	127-128	2	3
α-helix	134-142	9
β-strand	147-154	8	3
α-helix	168-179	12
α-helix	186-193	8
α-helix	198-212	15
α-helix	216-223	8
α-helix	226-236	11
α-helix	239-249	11
α-helix	253-255	3
α-helix	258-267	10
α-helix	270-284	15
α-helix	288-295	8
α-helix	298-308	11
α-helix	312-314	3
α-helix	321-334	14
α-helix	343-352	10
α-helix	355-368	14
α-helix	373-380	8
α-helix	383-411	29
α-helix	418-428	11
α-helix	433-444	12
α-helix	448-455	8
α-helix	458-468	11

Chain B: 24 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	71-77	7	5
β-strand	79	1	6
β-strand	83	1	6
β-strand	86-91	6	5
α-helix	92-94	3
β-strand	96-103	8	5
α-helix	108-112	5
β-strand	119-124	6	5
β-strand	127-128	2	5
α-helix	134-143	10
β-strand	147-154	8	5
α-helix	168-180	13
α-helix	186-193	8
α-helix	198-212	15
α-helix	216-223	8
α-helix	226-236	11
α-helix	239-251	13
α-helix	258-267	10
α-helix	270-284	15
α-helix	288-295	8
α-helix	298-308	11
α-helix	312-316	5
α-helix	321-333	13
α-helix	343-352	10
α-helix	355-368	14
α-helix	373-380	8
α-helix	383-397	15
α-helix	399-411	13
α-helix	418-427	10
α-helix	433-444	12
α-helix	448-455	8
α-helix	458-468	11

Chain C: 25 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	72-77	6	1
α-helix	78	1
β-strand	79	1	2
β-strand	83	1	2
β-strand	86-91	6	1
α-helix	92-94	3
β-strand	96-103	8	1
α-helix	108-112	5
α-helix	119	1
β-strand	120-124	5	1
β-strand	127-128	2	1
α-helix	134-142	9
β-strand	147-153	7	1
α-helix	165-180	16
α-helix	186-193	8
α-helix	198-212	15
α-helix	216-223	8
α-helix	226-236	11
α-helix	239-251	13
α-helix	258-267	10
α-helix	270-284	15
α-helix	288-295	8
α-helix	298-308	11
α-helix	312-315	4
α-helix	321-334	14
α-helix	343-352	10
α-helix	355-368	14
α-helix	373-380	8
α-helix	383-412	30
α-helix	418-428	11
α-helix	433-444	12
α-helix	448-455	8
α-helix	458-468	11

Chains D, E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	732-734	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-2-syntrophin,Annexin A2	A, B, C	protein	408	Homo sapiens	P07355 (AlphaFold model), Q9NY99 (AlphaFold model)
Ribosomal protein S6 kinase alpha-1	D, E, F	protein	11	Homo sapiens	Q15418 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7QQL_1 Gamma-2-syntrophin,Annexin A2 (chains A, B, C)
GSHMGNRRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFEDQAADQTGMLFVGDAVLQV
NGIHVENATHEEVVHLLRNAGDEVTITVEYLREAPGSAYTNFDAERDALNIETAIKTKGV
DEVTIVNILTNRSNEQRQDIAFAYQRRTKKELASALKSALSGHLETVILGLLKTPAQYDA
SELKASMKGLGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLM
VALAKGRRAEDGSVIDYELIDQDARDLYDAGVKRKGTDVPKWISIMTERSVPHLQKVFDR
YKSYSPYDMLESIRKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRI
MVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Sequence of entity 2 (D, E, F), FASTA

>7QQL_2 Ribosomal protein S6 kinase alpha-1 (chains D, E, F)
RRVRKLPSTTL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	14

Water and common crystallization additives (GOL) are not listed.

Primary citation

A scalable strategy to solve structures of PDZ domains and their complexes. Cousido-Siah, A., Carneiro, L., Kostmann, C. et al. Acta Crystallogr D Struct Biol (2022) 78:509-516. DOI 10.1107/S2059798322001784 · PubMed

Other PDB entries of the same protein (UniProt P07355 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HYV 1.42 Å, Human Annexin A2 with heparin hexasaccharide bound
1W7B 1.52 Å, Annexin A2: Does it induce membrane aggregation by a new multimeric state of the protein.
7QQM 1.6 Å, The PDZ domain of LRRC7 fused with ANXA2
7PC5 1.7 Å, The third PDZ domain of PDZD7 complexed with the PDZ-binding motif of EXOC4
7P73 1.85 Å, The PDZ domain of SYNJ2BP complexed with the PDZ-binding motif of HTLV1-TAX1
2HYU 1.86 Å, Human Annexin A2 with heparin tetrasaccharide bound
7ZVN 1.87 Å, Crystal structure of human Annexin A2 in complex with full phosphorothioate 5-10…
5LPX 1.9 Å, Crystal structure of PKC phosphorylation-mimicking mutant (S26E) Annexin A2
7P74 1.9 Å, The PDZ domain of SYNJ2BP complexed with the phosphorylated PDZ-binding motif of RSK1
7PC3 1.95 Å, The second PDZ domain of DLG1 complexed with the PDZ-binding motif of HTLV1-TAX1
7P70 2.0 Å, The PDZ-domain of SNTB1 complexed with the PDZ-binding motif of HPV35-E6
7PCB 2.0 Å, The PDZ domain of SNX27 fused with ANXA2

Browse structure collections

About this viewer

MolViewer shows 7QQL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.