7RJK: Human Bromodomain containing protein 3

Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with hnRNPK. Determined by X-ray diffraction at 1.85 Å resolution. Released 3 Aug 2022.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,486
Mol. weight: 31.84 kDa
Released: 3 Aug 2022

Explore 7RJK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7RJK contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	37-41	5
α-helix	42-47	6
α-helix	48-51	4
α-helix	57-59	3
α-helix	73-76	4
α-helix	83-91	9
α-helix	98-115	18
α-helix	121-138	18
α-helix	140-143	4

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	37-41	5
α-helix	42-47	6
α-helix	48-51	4
α-helix	57-59	3
α-helix	73-76	4
α-helix	83-91	9
α-helix	98-115	18
α-helix	121-137	17
α-helix	140-142	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 3	A, B	protein	123	Homo sapiens	Q15059 (AlphaFold model)
Heterogeneous nuclear ribonucleoprotein K	C, D	protein	10	Homo sapiens	P61978 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7RJK_1 Bromodomain-containing protein 3 (chains A, B)
SMPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKNPM
DMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMP
QEE

Sequence of entity 2 (C, D), FASTA

>7RJK_2 Heterogeneous nuclear ribonucleoprotein K (chains C, D)
VIGKGGKNIK

Primary citation

Uncovering the Bromodomain Interactome using Site-Specific Azide-Acetyllysine Photochemistry, Proteomic Profiling and Structural Characterization. Wagner, S., Fedorov, E., Sudhamalla, B. et al. bioRxiv (2021). DOI 10.1101/2021.07.28.453719

Other PDB entries of the same protein (UniProt Q15059 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QJU 1.2 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with…
3S92 1.36 Å, Crystal Structure of the second bromodomain of human BRD3 in complex with the inhibitor…
9NN4 1.37 Å, BET BRD3-BD1 in complex with peptide 7.2
2NXB 1.4 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3)
7TOA 1.41 Å, BRD3-BD1 in complex with RaPID linear peptide 3xAcK.1 (triAcK.1)
7LAY 1.45 Å, Crystal structure of the first bromodomain (BD1) of human BRD3 bound to SG3-179
8CV5 1.47 Å, Peptide 4.2B in complex with BRD3.2
7L72 1.5 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to Ro3280
7RJL 1.5 Å, Crystal structure of human Bromodomain containing protein 3 (BRD3) in complex with SHMT
7TO8 1.5 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.1 (diAcK.1)
7L9L 1.55 Å, Crystal structure of the second bromodomain (BD2) of human BRD3 bound to BI2536
7TO9 1.6 Å, BRD3-BD1 in complex with RaPID linear peptide 2xAcK.4xE (diAcK.4xE)

Browse structure collections

About this viewer

MolViewer shows 7RJK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.