7S4A: MRG15 complex with PALB2 peptide

MRG15 complex with PALB2 peptide. Determined by X-ray diffraction at 2.69 Å resolution. Released 4 May 2022.

Method: X-ray diffraction
Resolution: 2.69 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,148
Mol. weight: 53 kDa
Released: 4 May 2022

Explore 7S4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7S4A contains 29 α-helices and 6 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	165-176	12
β-strand	180-182	3	1
β-strand	189	1	2
α-helix	190-201	12
α-helix	213-228	16
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-257	4
β-strand	259	1	2
α-helix	260-274	15
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	1
α-helix	314-315	2
α-helix	316-319	4

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	600-606	7
α-helix	616-627	12

Chain C: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	165-176	12
β-strand	180-182	3	3
α-helix	186	1
α-helix	190-202	13
α-helix	212-228	17
α-helix	236-238	3
α-helix	239-248	10
α-helix	254-257	4
α-helix	260-274	15
α-helix	281-300	20
α-helix	302-305	4
α-helix	308-310	3
β-strand	311-313	3	3
α-helix	314-315	2
α-helix	316-318	3

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	596-606	11
α-helix	616-627	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mortality factor 4-like protein 1	A, C	protein	172	Homo sapiens	Q9UBU8 (AlphaFold model)
Partner and localizer of BRCA2	B, D	protein	57	Homo sapiens	Q86YC2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>7S4A_1 Mortality factor 4-like protein 1 (chains A, C)
NRVEVKVKIPEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNKE
YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYGAPHLLRLFVRIG
AMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLFSASDYEVAPPEYHRKAV

Sequence of entity 2 (B, D), FASTA

>7S4A_2 Partner and localizer of BRCA2 (chains B, D)
MHHHHHHSSGVDLGTENLYFQSNMLSLKQLLSFLSITDFQLPDEDFGPLKLEKVKSC

Primary citation

Structural Insight into the Mechanism of PALB2 Interaction with MRG15. Redington, J., Deveryshetty, J., Kanikkannan, L. et al. Genes (Basel) (2021) 12. DOI 10.3390/genes12122002 · PubMed

Other PDB entries of the same protein (UniProt Q9UBU8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2F5J 2.2 Å, Crystal structure of MRG domain from human MRG15
2F5K 2.2 Å, Crystal structure of the chromo domain of human MRG15
2AQL 2.3 Å, Crystal Structure of the MRG15 MRG domain
6INE 2.6 Å, Crystal Structure of human ASH1L-MRG15 complex
6AGO 3.1 Å, Crystal structure of MRG15-ASH1L Histone methyltransferase complex
8C60 3.4 Å, Cryo-EM structure of the human SIN3B full-length complex at 3.4 Angstrom resolution
8BPA 3.7 Å, Cryo-EM structure of the human SIN3B histone deacetylase complex at 3.7 Angstrom
2EFI Solution structure of the chromo domain of Mortality factor 4-like protein 1 from human
2LKM Structural Basis for Molecular Interactions Involving MRG Domains: Implications in…
2N1D Solution structure of the MRG15-MRGBP complex

Browse structure collections

About this viewer

MolViewer shows 7S4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.