7SEH: Glucose-6-phosphate 1-dehydrogenase

Glucose-6-phosphate 1-dehydrogenase (K403QdLtL). Determined by X-ray diffraction at 2.9 Å resolution. Released 17 Aug 2022.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,291
Mol. weight: 121.25 kDa
Ligands: NAP
Released: 17 Aug 2022

Explore 7SEH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SEH contains 55 α-helices and 33 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 30 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	31-37	7	1
α-helix	42-43	2
α-helix	44-48	5
α-helix	49-57	9
β-strand	64-71	8	1
α-helix	77-84	8
α-helix	92-94	3
α-helix	95-104	10
β-strand	105-109	5	1
α-helix	115-126	12
α-helix	131-133	3
β-strand	135-140	6	1
α-helix	147-153	7
α-helix	154-158	5
β-strand	165-169	5	1
α-helix	170	1
α-helix	172	1
α-helix	177-187	11
α-helix	193-195	3
β-strand	196-198	3	1
α-helix	207-221	15
α-helix	222-224	3
β-strand	230-238	9	2
α-helix	247-250	4
α-helix	255	1
α-helix	256-264	9
α-helix	265-272	8
α-helix	281-293	13
β-strand	295	1	3
α-helix	296-299	4
α-helix	300-302	3
β-strand	303-309	7	2
α-helix	310	1
α-helix	329	1
β-strand	337-343	7	2
β-strand	344	1	3
β-strand	353-359	7	2
β-strand	366-373	8	2
α-helix	374-375	2
β-strand	388-393	6	2
β-strand	401-404	4	2
α-helix	436-446	11
α-helix	455-475	21
α-helix	479	1
β-strand	480-483	4	2
α-helix	490-498	9

Chain B: 25 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	32-37	6	4
α-helix	42	1
α-helix	43-48	6
α-helix	49-57	9
β-strand	65-71	7	4
α-helix	77-82	6
α-helix	86-88	3
α-helix	95-102	8
β-strand	105-109	5	4
α-helix	115-127	13
β-strand	135-140	6	4
α-helix	147-153	7
α-helix	154-158	5
β-strand	165-169	5	4
α-helix	177-190	14
α-helix	193-195	3
β-strand	196-198	3	4
α-helix	207-221	15
α-helix	222-224	3
β-strand	230-238	9	5
α-helix	247-250	4
α-helix	254-255	2
α-helix	256-264	9
α-helix	265-272	8
α-helix	281-293	13
β-strand	295	1	6
α-helix	300-302	3
β-strand	303-309	7	5
α-helix	316-319	4
β-strand	337-342	6	5
β-strand	344	1	6
β-strand	354-359	6	5
β-strand	366-373	8	5
α-helix	385-387	3
β-strand	388-392	5	5
β-strand	401-404	4	5
α-helix	437-445	9
β-strand	453	1	4
α-helix	455-474	20
α-helix	477-479	3
β-strand	480-483	4	5
α-helix	491-498	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glucose-6-phosphate 1-dehydrogenase	A, B	protein	520	Homo sapiens	P11413 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7SEH_1 Glucose-6-phosphate 1-dehydrogenase (chains A, B)
GSHMMAEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLF
RDGLLPENTFIVGYARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAA
SYQRLNSHMNALHLGSQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRD
LQSSDRLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILT
FKEPFGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPCSTNSDDVRDEKVKVLKCIS
EVQANNVVLGQYVGNPDGEGEATKGYLDDPTVPRGSTTATFAAVVLYVENERWDGVPFIL
RCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELVIRVQPNEAVYTQMMTKKPGMFFNPE
ESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEK
PKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKLC

Ligands and cofactors

ID	Name	Formula	Copies
NAP	NADP nicotinamide-adenine-dinucleotide phosphate	C21 H28 N7 O17 P3	2

Primary citation

Stabilization of glucose-6-phosphate dehydrogenase oligomers enhances catalytic activity and stability of clinical variants. Garcia, A.A., Mathews, I.I., Horikoshi, N. et al. J Biol Chem (2022) 298:101610-101610. DOI 10.1016/j.jbc.2022.101610 · PubMed

Other PDB entries of the same protein (UniProt P11413 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JYU 1.89 Å, Crystal structure of Human G6PD Canton
6E08 1.9 Å, Crystal structure of G6PD in complex with structural NADP
7SNH 2.2 Å, Structure of G6PD-D200N tetramer bound to NADP+
7ZVE 2.28 Å, K403 acetylated glucose-6-phosphate dehydrogenase (G6PD)
7ZVD 2.46 Å, K89 acetylated glucose-6-phosphate dehydrogenase (G6PD) in a complex with structural NADP+
2BH9 2.5 Å, X-ray structure of a deletion variant of human glucose 6-phosphate dehydrogenase…
7SNI 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ and G6P
7UC2 2.5 Å, Structure of G6PD-D200N tetramer bound to NADP+ with no symmetry applied
6E07 2.6 Å, Crystal structure of Canton G6PD in complex with structural NADP
5UKW 2.65 Å, Crystal structure of human Glucose 6-phosphate Dehydrogenase mutant (A277C) complexed…
7SNG 2.8 Å, structure of G6PD-WT tetramer
2BHL 2.9 Å, X-ray structure of human glucose-6-phosphate dehydrogenase (deletion variant) complexed…

Browse structure collections

About this viewer

MolViewer shows 7SEH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.