7SL1: Full-length insulin receptor

Full-length insulin receptor bound with site 1 binding deficient mutant insulin (A-V3E). Determined by electron microscopy at 3.4 Å resolution. Released 30 Mar 2022.

Method: Electron microscopy
Resolution: 3.4 Å
Organisms: Mus musculus, Homo sapiens
Chains: 6
Atoms: 13,830
Mol. weight: 323.28 kDa
Released: 30 Mar 2022

Explore 7SL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7SL1 contains 43 α-helices and 136 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 67 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	17-23	7
β-strand	28-38	11	1
α-helix	43-46	4
β-strand	56-57	2	1
β-strand	61-66	6	1
β-strand	71	1	2
β-strand	81-82	2	1
β-strand	91-96	6	1
β-strand	103	1	2
β-strand	111-112	2	1
β-strand	116-122	7	1
β-strand	137	1	1
β-strand	144-148	5	1
β-strand	171-172	2	3
β-strand	179-180	2	3
β-strand	201	1	4
β-strand	207	1	4
β-strand	213	1	5
β-strand	215	1	5
β-strand	216	1	6
β-strand	225	1	6
β-strand	231-233	3	7
β-strand	236-238	3	7
α-helix	241-242	2
β-strand	245-248	4	7
β-strand	252-255	4	7
α-helix	256-267	12
β-strand	278-280	3	7
β-strand	283-285	3	7
β-strand	292-294	3	8
β-strand	300	1	7
β-strand	301-303	3	8
β-strand	311-321	11	9
α-helix	324-329	6
β-strand	335-342	8	9
α-helix	353-358	6
β-strand	363-364	2	9
β-strand	368-371	4	9
β-strand	378	1	10
β-strand	387-388	2	9
β-strand	398-403	6	9
β-strand	410	1	10
β-strand	420-421	2	9
β-strand	425-429	5	9
β-strand	433	1	11
α-helix	436-446	11
β-strand	457	1	9
β-strand	463	1	11
β-strand	471-473	3	12
β-strand	475-480	6	13
β-strand	485-489	5	13
α-helix	497-499	3
β-strand	500-509	10	12
β-strand	530-534	5	12
α-helix	535-537	3
β-strand	552-555	4	13
α-helix	558-559	2
β-strand	563-572	10	12
β-strand	583-585	3	12
β-strand	588-591	4	12
α-helix	592-594	3
β-strand	604-607	4	14
β-strand	613-616	4	14
β-strand	629-636	8	15
α-helix	638-640	3
α-helix	641-643	3
α-helix	692-710	19
β-strand	761-765	5	15
β-strand	769-772	4	14
β-strand	780-788	9	15
α-helix	798-800	3
β-strand	801-806	6	15
α-helix	807-810	4
β-strand	821	1	16
β-strand	830-832	3	17
β-strand	833	1	16
β-strand	844-852	9	18
β-strand	858-864	7	18
α-helix	865-871	7
β-strand	874-876	3	17
β-strand	883-892	10	18
β-strand	896	1	18
α-helix	898-902	5
β-strand	903-906	4	18

Chain B: 19 helices, 69 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	19
α-helix	17-23	7
β-strand	28-38	11	19
α-helix	43-46	4
β-strand	56-57	2	19
β-strand	60-66	7	19
β-strand	71	1	20
β-strand	81-82	2	19
β-strand	91-96	6	19
β-strand	103	1	20
β-strand	111-112	2	19
β-strand	116-122	7	19
β-strand	137	1	19
β-strand	144-148	5	19
β-strand	171-172	2	21
β-strand	179-180	2	21
β-strand	201	1	22
β-strand	207	1	22
β-strand	213	1	23
β-strand	215	1	23
β-strand	216	1	24
β-strand	225	1	24
β-strand	231-233	3	25
β-strand	236-238	3	25
α-helix	241-242	2
β-strand	245-248	4	25
β-strand	252-255	4	25
α-helix	256-267	12
β-strand	278-280	3	25
β-strand	283-285	3	25
β-strand	292-294	3	26
β-strand	300	1	25
β-strand	301-303	3	26
β-strand	311-313	3	27
α-helix	315-317	3
β-strand	319-321	3	28
α-helix	324-329	6
β-strand	335-337	3	27
β-strand	340-342	3	28
α-helix	353-358	6
β-strand	363-364	2	27
β-strand	368-371	4	28
β-strand	378	1	29
β-strand	387-388	2	27
β-strand	398-403	6	28
β-strand	410	1	29
β-strand	420-421	2	27
β-strand	425-429	5	28
β-strand	433	1	30
α-helix	436-446	11
β-strand	457	1	28
β-strand	463	1	30
β-strand	471-473	3	31
β-strand	475-480	6	32
β-strand	485-489	5	32
α-helix	497-499	3
β-strand	500-509	10	31
β-strand	530-534	5	31
α-helix	535-537	3
β-strand	552-555	4	32
α-helix	558-559	2
β-strand	563-572	10	31
β-strand	583-585	3	31
β-strand	588-591	4	31
α-helix	592-594	3
β-strand	604-607	4	33
β-strand	613-616	4	33
β-strand	629-636	8	34
α-helix	638-640	3
α-helix	641-643	3
α-helix	692-710	19
β-strand	761-765	5	34
β-strand	769-772	4	33
β-strand	780-788	9	34
α-helix	798-800	3
β-strand	801-806	6	34
α-helix	807-810	4
β-strand	821	1	35
β-strand	830-832	3	36
β-strand	833	1	35
β-strand	844-852	9	37
β-strand	858-864	7	37
α-helix	865-871	7
β-strand	874-876	3	36
β-strand	883-892	10	37
β-strand	896	1	37
α-helix	898-902	5
β-strand	903-906	4	37

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10

Chains E and F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
α-helix	13-17	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	1372	Mus musculus	P15208 (AlphaFold model)
Insulin B chain	C, D	protein	30	Homo sapiens	P01308 (AlphaFold model)
Insulin A chain	E, F	protein	21	Homo sapiens	P01308 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7SL1_1 Insulin receptor (chains A, B)
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
RSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS

Sequence of entity 2 (C, D), FASTA

>7SL1_2 Insulin B chain (chains C, D)
FVNQHLCGSHLVEALYLVCGERGFFYTPKT

Sequence of entity 3 (E, F), FASTA

>7SL1_3 Insulin A chain (chains E, F)
GIEEQCCTSICSLYQLENYCN

Primary citation

Synergistic activation of the insulin receptor via two distinct sites. Li, J., Park, J., Mayer, J.P. et al. Nat Struct Mol Biol (2022) 29:357-368. DOI 10.1038/s41594-022-00750-6 · PubMed

Other PDB entries of the same protein (UniProt P15208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
7SL7 3.1 Å, Full-length insulin receptor bound with both site 1 binding deficient mutant insulin…
7SL3 3.4 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7STH 3.5 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulin bound)…
8DTM 3.5 Å, Cryo-EM structure of insulin receptor (IR) bound with S597 component 2
7SL2 3.6 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7SL6 3.7 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (B-L17R)…
8EZ0 3.7 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STK 4.0 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
7STJ 4.4 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
8EYX 4.5 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STI 4.9 Å, Full-length insulin receptor bound with unsaturated insulin WT (1 insulin bound)…

Browse structure collections

About this viewer

MolViewer shows 7SL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.