7STK: Full-length insulin receptor

Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound) asymmetric conformation (Conformation 2). Determined by electron microscopy at 4.0 Å resolution. Released 30 Mar 2022.

Method: Electron microscopy
Resolution: 4.0 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 13,911
Mol. weight: 335.56 kDa
Released: 30 Mar 2022

Explore 7STK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7STK contains 54 α-helices and 149 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 76 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	1
β-strand	12-13	2	2
α-helix	18-23	6
β-strand	28-29	2	3
β-strand	30	1	1
β-strand	33-38	6	2
α-helix	43-46	4
β-strand	56-57	2	3
β-strand	61-66	6	2
α-helix	72-75	4
β-strand	81-82	2	3
β-strand	93-98	6	2
β-strand	111-112	2	3
β-strand	117-122	6	2
α-helix	133-136	4
β-strand	144-145	2	2
β-strand	148	1	2
β-strand	171-173	3	4
β-strand	178-180	3	4
β-strand	182	1	5
β-strand	188	1	5
β-strand	201	1	6
β-strand	207	1	6
β-strand	212-216	5	7
α-helix	222-224	3
β-strand	225-228	4	7
β-strand	231-233	3	8
β-strand	236-238	3	8
α-helix	241-242	2
α-helix	245	1
β-strand	246-248	3	8
β-strand	252-254	3	8
α-helix	256-267	12
β-strand	279	1	9
β-strand	280	1	8
β-strand	283	1	8
β-strand	292-293	2	10
β-strand	300	1	9
β-strand	302-303	2	10
α-helix	304	1
β-strand	311-313	3	11
β-strand	318-321	4	12
α-helix	325-330	6
β-strand	335-337	3	11
β-strand	339-342	4	12
α-helix	352-357	6
β-strand	363-364	2	11
β-strand	368-371	4	12
β-strand	378	1	13
β-strand	387-388	2	11
β-strand	394	1	12
β-strand	398-403	6	12
β-strand	410	1	13
β-strand	420-421	2	11
β-strand	425-429	5	12
α-helix	436-446	11
β-strand	457	1	12
β-strand	472	1	14
β-strand	475-480	6	15
β-strand	485-489	5	15
α-helix	497-499	3
β-strand	500	1	16
β-strand	503-509	7	14
β-strand	530-534	5	14
α-helix	535-537	3
β-strand	551-552	2	15
β-strand	561-567	7	14
β-strand	570	1	16
β-strand	582	1	14
β-strand	586-589	4	14
α-helix	597-598	2
β-strand	599-605	7	17
β-strand	611-616	6	17
β-strand	627-635	9	18
α-helix	636-638	3
α-helix	639-642	4
α-helix	686-688	3
α-helix	689-713	25
β-strand	759-762	4	18
β-strand	767-770	4	17
β-strand	778-786	9	18
β-strand	795	1	18
α-helix	797-798	2
β-strand	799-804	6	18
α-helix	805-808	4
β-strand	813	1	19
α-helix	817-818	2
β-strand	819-822	4	20
β-strand	828-831	4	20
β-strand	842-847	6	21
β-strand	850	1	22
β-strand	856	1	22
β-strand	859-862	4	21
α-helix	863-869	7
β-strand	872-874	3	20
α-helix	877-878	2
β-strand	881-882	2	23
β-strand	886-890	5	21
β-strand	894-897	4	21
α-helix	898-899	2
β-strand	903-904	2	23

Chain B: 22 helices, 71 β-strands

Element	Residues	Length	Sheet
β-strand	11-13	3	24
α-helix	18-23	6
β-strand	28-29	2	25
β-strand	32-38	7	24
α-helix	43-45	3
β-strand	56-57	2	25
β-strand	60-66	7	24
β-strand	71	1	26
α-helix	72-74	3
β-strand	81-82	2	25
β-strand	88	1	24
β-strand	91-96	6	24
β-strand	103	1	26
β-strand	111-112	2	25
β-strand	116-122	7	24
β-strand	137	1	25
β-strand	144-148	5	24
β-strand	171-173	3	27
β-strand	178-180	3	27
β-strand	201	1	28
β-strand	207	1	28
β-strand	212-216	5	29
α-helix	222-224	3
β-strand	225-228	4	29
β-strand	232	1	30
α-helix	241-242	2
β-strand	246-248	3	30
β-strand	252-254	3	30
α-helix	256-267	12
β-strand	279	1	31
β-strand	280	1	30
β-strand	283	1	30
β-strand	292-294	3	32
β-strand	300	1	31
β-strand	301-303	3	32
β-strand	311	1	33
α-helix	315-317	3
β-strand	318-321	4	34
α-helix	324-327	4
α-helix	328-330	3
β-strand	335-336	2	33
β-strand	339-342	4	34
α-helix	351-357	7
β-strand	363-364	2	33
β-strand	368-371	4	34
β-strand	378	1	35
α-helix	379-381	3
β-strand	387-388	2	33
α-helix	393	1
β-strand	394	1	36
β-strand	398	1	36
β-strand	400-403	4	34
β-strand	410	1	35
β-strand	420-421	2	33
β-strand	425	1	36
β-strand	428-429	2	34
α-helix	436-446	11
β-strand	457	1	34
β-strand	472-473	2	37
β-strand	477-479	3	38
β-strand	486-488	3	38
β-strand	502-509	8	37
β-strand	530-534	5	37
α-helix	535-538	4
β-strand	551-552	2	38
α-helix	556-557	2
β-strand	561-569	9	37
β-strand	582-583	2	37
β-strand	586-589	4	37
α-helix	597-598	2
β-strand	599-604	6	39
β-strand	611-616	6	39
β-strand	627-634	8	40
α-helix	639-642	4
α-helix	690-694	5
α-helix	705-714	10
β-strand	759-762	4	40
β-strand	767-770	4	39
β-strand	778-788	11	40
β-strand	794-795	2	40
β-strand	799-804	6	40
α-helix	805-807	3
β-strand	819-822	4	41
β-strand	828-831	4	41
β-strand	842-851	10	42
β-strand	856-862	7	42
α-helix	863-868	6
β-strand	872-874	3	41
β-strand	881	1	43
β-strand	882-890	9	42
β-strand	894	1	42
α-helix	896-900	5
β-strand	904	1	43

Chain C: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	9-18	10
β-strand	24	1	44
α-helix	58-61	4
α-helix	68-71	4
α-helix	72-74	3
β-strand	75	1	44

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	9-17	9
α-helix	57-61	5
α-helix	68-73	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	1372	Mus musculus	P15208 (AlphaFold model)
Insulin	C, D	protein	110	Homo sapiens	P01308 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7STK_1 Insulin receptor (chains A, B)
MGFGRGCETTAVPLLVAVAALLVGTAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDVCPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHKECL
GNCSEPDDPTKCVACRNFYLDGQCVETCPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPG
CHQYVIHNNKCIPECPSGYTMNSSNLMCTPCLGPCPKVCQILEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGFLKIRRSYALVSLSFFRKLHLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSFIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPQRSNDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVT
FSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVY
WERQAEDSELFELDYCLKGLKLPSRTWSPPFESDDSQKHNQSEYDDSASECCSCPKTDSQ
ILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPT
SQEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDSPDERCSVAAYVSARTMPEAKA
DDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCVSRKHFALERG
CRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSV
VIGSIYLFLRKRQPDGPMGPLYASSNPEYLSASDVFPSSVYVPDEWEVPREKITLLRELG
QGSFGMVYEGNAKDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLL
GVVSKGQPTLVVMELMAHGDLKSHLRSLRPDAENNPGRPPPTLQEMIQMTAEIADGMAYL
NAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKD
GVFTASSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMR
MCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFYSEENKAPESEELEMEFEDMENVPLD
RSSHCQREEAGGREGGSSLSIKRTYDEHIPYTHMNGGKKNGRVLTLPRSNPS

Sequence of entity 2 (C, D), FASTA

>7STK_2 Insulin (chains C, D)
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN

Primary citation

Synergistic activation of the insulin receptor via two distinct sites. Li, J., Park, J., Mayer, J.P. et al. Nat Struct Mol Biol (2022) 29:357-368. DOI 10.1038/s41594-022-00750-6 · PubMed

Other PDB entries of the same protein (UniProt P15208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
7SL7 3.1 Å, Full-length insulin receptor bound with both site 1 binding deficient mutant insulin…
7SL1 3.4 Å, Full-length insulin receptor bound with site 1 binding deficient mutant insulin (A-V3E)
7SL3 3.4 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7STH 3.5 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulin bound)…
8DTM 3.5 Å, Cryo-EM structure of insulin receptor (IR) bound with S597 component 2
7SL2 3.6 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7SL6 3.7 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (B-L17R)…
8EZ0 3.7 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STJ 4.4 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
8EYX 4.5 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STI 4.9 Å, Full-length insulin receptor bound with unsaturated insulin WT (1 insulin bound)…

Browse structure collections

About this viewer

MolViewer shows 7STK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.