7T9M: CS-17 Heavy Chain

Human Thyrotropin receptor bound by CS-17 Inverse Agonist Fab/Org 274179-0 Antagonist. Determined by electron microscopy at 3.1 Å resolution. Released 10 Aug 2022.

Method: Electron microscopy
Resolution: 3.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 3
Atoms: 7,827
Mol. weight: 127.39 kDa
Ligands: NAG
Released: 10 Aug 2022

Explore 7T9M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7T9M contains 28 α-helices and 68 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	18-19	2	1
β-strand	22-25	4	1
α-helix	29-31	3
β-strand	32-39	8	2
β-strand	45-52	8	2
β-strand	58-60	3	2
β-strand	65	1	1
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-100	9	2
β-strand	110-111	2	2
β-strand	115-119	5	2
β-strand	124	1	3
β-strand	127-131	5	4
α-helix	137-139	3
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-160	3	5
α-helix	165-167	3
β-strand	171-172	2	4
α-helix	173-175	3
β-strand	176-178	3	4
β-strand	181-191	11	4
α-helix	192-194	3
β-strand	202-205	4	5
β-strand	213-215	3	5

Chain L: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-25	7	6
β-strand	33-37	5	7
β-strand	44-49	6	7
β-strand	52-53	2	7
β-strand	61-66	6	6
β-strand	69-74	6	6
α-helix	79-81	3
β-strand	84-89	6	7
β-strand	96-97	2	7
β-strand	102-105	4	7
β-strand	115-117	3	8
α-helix	118-120	3
α-helix	121-126	6
β-strand	129-138	10	8
β-strand	144-149	6	9
β-strand	152-154	3	9
β-strand	158-159	2	8
β-strand	162	1	8
α-helix	163-166	4
β-strand	172-180	9	8
α-helix	182-187	6
β-strand	190-196	7	9
α-helix	203	1
β-strand	204-209	6	9

Chain R: 16 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	30	1	10
β-strand	33	1	11
β-strand	37	1	11
β-strand	40	1	10
β-strand	56-58	3	10
β-strand	66-67	2	12
β-strand	80-84	5	10
β-strand	91-92	2	12
β-strand	97-98	2	13
β-strand	105-109	5	10
β-strand	116-117	2	12
β-strand	122-123	2	13
β-strand	130-134	5	10
β-strand	149	1	14
β-strand	153-159	7	10
β-strand	166-167	2	15
α-helix	168	1
β-strand	176	1	14
β-strand	179-183	5	10
β-strand	191-192	2	15
β-strand	202-206	5	10
β-strand	215-216	2	15
β-strand	231-232	2	10
β-strand	251-253	3	10
α-helix	265-268	4
β-strand	274-276	3	10
α-helix	280-287	8
β-strand	397-398	2	10
α-helix	415-441	27
α-helix	445-446	2
α-helix	448-476	29
α-helix	481-483	3
α-helix	485-490	6
α-helix	492-524	33
α-helix	532-534	3
α-helix	535-554	20
α-helix	555-558	4
α-helix	577-609	33
α-helix	617-649	33
α-helix	656-681	26
α-helix	683-692	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CS-17 Heavy Chain	H	protein	217	Mus musculus
CS-17 Light Chain	L	protein	213	Mus musculus
Thyrotropin receptor	R	protein	702	Homo sapiens	P16473 (AlphaFold model)

Sequence of entity 1 (H), FASTA

>7T9M_1 CS-17 Heavy Chain (chains H)
EVQLQQSGPELVKPGASVKMSCKASGYTFTSYIIHWVKQKPGQGLEWIGYINLYNDGTNY
NEKFTGKATLTSDKSSSTAYMELSSLTSEDSAVYYCAREDYYGRVADFDVWGAGTTVTVS
SKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKI

Sequence of entity 2 (L), FASTA

>7T9M_2 CS-17 Light Chain (chains L)
HLVLTQSPAIMSASPGEKVTISCSASSSVSYMCWFQQKPGSSPKPWIYRTSNLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCQQYHSYPLTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (R), FASTA

>7T9M_3 Thyrotropin receptor (chains R)
DYKDDDDGTMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAF
SNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLG
IFNTGLKMFPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSV
QGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLDVSQTSVTALPSKGLEHLKEL
IARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLMCNESSMQSLRQR
KSVNGQELKNPQEETLQAFDSHYDYTICGDSEDMVCTPKSDEFNPCEDIMGYKFLRIVVW
FVSLLALLGNVFVLLILLTSHYKLNVPRFLMCNLAFADFCMGMYLLLIASVDLYTHSEYY
NHAIDWQTGPGCNTAGFFTVFASELSVYTLTVITLERWYAITFAMRLDRKIRLRHACAIM
VGGWVCCFLLALLPLVGISSYAKVSICLPMDTETPLALAYIVFVLTLNIVAFVIVCCCYV
KIYITVRNPQYNPGDKDTKIAKRMAVLIFTDFICMAPISFYALSAILNKPLITVSNSKIL
LVLFYPLNSCANPFLYAIFTKAFQRDVFILLSKFGICKRQAQAYRGQRVPPKNSTDIQVQ
KVTHEMRQGLHNMEDVYELIENSHLTPKKQGQISEEYMQTVL

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Autoantibody mimicry of hormone action at the thyrotropin receptor. Faust, B., Billesbolle, C.B., Suomivuori, C.M. et al. Nature (2022) 609:846-853. DOI 10.1038/s41586-022-05159-1 · PubMed

Other PDB entries of the same protein (UniProt P16473 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2XWT 1.9 Å, Crystal structure of the tsh receptor in complex with a blocking type tshr autoantibody
7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
3G04 2.55 Å, Crystal structure of the TSH receptor in complex with a thyroid-stimulating autoantibody
7XW6 2.78 Å, TSHR-Gs-M22 antibody-ML109 complex
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
7T9N 2.9 Å, M22 Agonist Autoantibody bound to Human Thyrotropin receptor in complex with miniGs399…
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
7XW7 5.5 Å, TSHR-K1-70 complex

Browse structure collections

About this viewer

MolViewer shows 7T9M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.