7TCY: Non-receptor tyrosine-protein kinase TNK1

The ubiquitin-associated domain of human thirty-eight negative kinase I. Determined by X-ray diffraction at 1.54 Å resolution. Released 11 Jan 2023.

Method: X-ray diffraction
Resolution: 1.54 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,382
Mol. weight: 17.88 kDa
Ligands: PO4, MG
Released: 11 Jan 2023

Explore 7TCY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TCY contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	590-601	12
α-helix	607-616	10
α-helix	621-637	17
α-helix	641-650	10
α-helix	655-663	9

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	590-601	12
α-helix	607-616	10
α-helix	621-634	14
α-helix	641-650	10
α-helix	655-664	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-receptor tyrosine-protein kinase TNK1	A, B	protein	78	Homo sapiens	Q13470 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7TCY_1 Non-receptor tyrosine-protein kinase TNK1 (chains A, B)
GELQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRIL
EHYQWDLSAASRYVLARP

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (FMT, CL) are not listed.

Primary citation

Fusion crystallization reveals the behavior of both the 1TEL crystallization chaperone and the TNK1 UBA domain. Nawarathnage, S., Tseng, Y.J., Soleimani, S. et al. Structure (2023) 31:1589-1603.e6. DOI 10.1016/j.str.2023.09.001 · PubMed

Other PDB entries of the same protein (UniProt Q13470 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7T8J 1.89 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused…
9ZVU 1.96 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to…
9NGE 2.02 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to…
9Z2L 2.02 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 rigidly fused to…
7U4Z 2.03 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused…
7U4W 2.1 Å, The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused…
9O0H 2.24 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the…
9CPL 2.4 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the…

Browse structure collections

About this viewer

MolViewer shows 7TCY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.