7U4Z: PDB entry 7U4Z

The ubiquitin-associated domain of human thirty-eight negative kinase-1 flexibly fused to the 1TEL crystallization chaperone via a 2-glycine linker and crystallized at very low protein concentration. Determined by X-ray diffraction at 2.03 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 2.03 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,237
Mol. weight: 17.81 kDa
Released: 8 Mar 2023

Explore 7U4Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7U4Z contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-6	2
α-helix	13-15	3
α-helix	18-32	15
α-helix	34-38	5
α-helix	39-41	3
α-helix	46-51	6
α-helix	54-60	7
α-helix	65-70	6
α-helix	71-75	5
α-helix	78-90	13
α-helix	96-106	11
α-helix	110-123	14
α-helix	130-139	10
α-helix	144-152	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1	A	protein	155	Homo sapiens	P41212 (AlphaFold model), Q13470 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7U4Z_1 Transcription factor ETV6,Non-receptor tyrosine-protein kinase TNK1 (chains A)
GSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYR
SPHSGDELYELLQHILGGELQRKIMEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVD
QLFHLSSRSRADAWRILEHYQWDLSAASRYVLARP

Primary citation

Fusion crystallization reveals the behavior of both the 1TEL crystallization chaperone and the TNK1 UBA domain. Nawarathnage, S., Tseng, Y.J., Soleimani, S. et al. Structure (2023) 31:1589. DOI 10.1016/j.str.2023.09.001 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 7U4Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.