9CPL: PDB entry 9CPL

The ubiquitin-associated domain of human thirty-eight negative kinase 1, fused to the 2TEL crystallization chaperone via a 2-glycine linker. Determined by X-ray diffraction at 2.4 Å resolution. Released 14 Aug 2024.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,808
Mol. weight: 29.14 kDa
Released: 14 Aug 2024

Explore 9CPL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9CPL contains 20 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	18-20	3
α-helix	24-26	3
α-helix	29-42	14
α-helix	45-47	3
α-helix	50-53	4
α-helix	57-60	4
α-helix	65-71	7
α-helix	76-89	14
α-helix	103-105	3
α-helix	109-111	3
α-helix	114-127	14
α-helix	130-132	3
α-helix	135-138	4
α-helix	142-145	4
α-helix	150-156	7
α-helix	161-184	24
α-helix	192-201	10
α-helix	206-221	16
α-helix	226-235	10
α-helix	240-249	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
2TEL/Non-receptor tyrosine-protein kinase TNK1 fusion protein	A	protein	251	Homo sapiens	P41212 (AlphaFold model), Q13470 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9CPL_1 2TEL/Non-receptor tyrosine-protein kinase TNK1 fusion protein (chains A)
MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLSPIDSNTFEMNGKAL
LLLTKEDFRYRSPHSGDELYELLQHILKQRPGGGGSTSIRLPAHLRLQPIYWSRDDVAQW
LKWAENEFSLSPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILGGELQRKI
MEVELSVHGVTHQEAQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADAWRILEHYQWDL
SAASRYVLARP

Primary citation

1TEL Fusions Outperform 2TEL and 3TEL Fusions in Controlled Comparisons. Samarawickrama, P., Ludlow, K., Probst, R. et al. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 9CPL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.