7TRL: Human BIRC2 BIR3 domain

Name: PDB 7TRL: Crystal structure of human BIRC2 BIR3 domain in complex with histone H3
Published: 2023-08-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: apoptosis

Crystal structure of human BIRC2 BIR3 domain in complex with histone H3. Determined by X-ray diffraction at 1.74 Å resolution. Released 2 Aug 2023.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 2
Atoms: 835
Mol. weight: 12.57 kDa
Ligands: ZN
Released: 2 Aug 2023

Explore 7TRL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TRL contains 7 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	264-266	3
α-helix	269-274	6
α-helix	275-278	4
α-helix	287-292	6
β-strand	295-297	3	1
β-strand	304-306	3	1
β-strand	312-314	3	1
α-helix	322-329	8
α-helix	334-340	7
α-helix	342-344	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	2-3	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Baculoviral IAP repeat-containing protein 2	A	protein	94	Homo sapiens	Q13490 (AlphaFold model)
Histone H3	B	protein	12	Homo sapiens	Q6NXT2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7TRL_1 Baculoviral IAP repeat-containing protein 2 (chains A)
GPLGSPEFISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGG
LRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVD

Sequence of entity 2 (B), FASTA

>7TRL_2 Histone H3 (chains B)
ARTKQTARKSTG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Molecular basis for nuclear accumulation and targeting of the inhibitor of apoptosis BIRC2. Tencer, A.H., Yu, Y., Causse, S.Z. et al. Nat Struct Mol Biol (2023) 30:1265-1274. DOI 10.1038/s41594-023-01044-1 · PubMed

Other PDB entries of the same protein (UniProt Q13490 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HY4 1.25 Å, Crystal structure of cIAP1 BIR3 bound to T3170284
7QGJ 1.3 Å, Apo structure of BIR2 Domain of BIRC2
3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
8DSF 1.5 Å, Structure of cIAP1 with BCCov
4KMN 1.52 Å, Structure of cIAP1-BIR3 and inhibitor
4LGE 1.55 Å, Crystal structure of clAP1 BIR3 bound to T3261256
6HPR 1.7 Å, Crystal structure of cIAP1 RING domain bound to UbcH5B-Ub and a non-covalent Ub
4HY5 1.75 Å, Crystal structure of cIAP1 BIR3 bound to T3256336
3UW4 1.79 Å, Crystal structure of cIAP1 BIR3 bound to GDC0152
4MU7 1.79 Å, Crystal structure of cIAP1 BIR3 bound to T3450325
5M6N 1.8 Å, Small Molecule inhibitors of IAP
9N23 1.8 Å, Crystal structure of cIAP1-BIR3 with XB2 series SMAC mimetic ligand

Browse structure collections

About this viewer

MolViewer shows 7TRL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.