7TUQ: BRD4 bromodomain 1

Crystal structure of BRD4 bromodomain 1 in complex with monoacetylated SARS-CoV-2 E. Determined by X-ray diffraction at 2.68 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 2.68 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 3
Atoms: 2,021
Mol. weight: 33.87 kDa
Released: 6 Jul 2022

Explore 7TUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7TUQ contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	44-49	6
α-helix	61-65	5
α-helix	66-71	6
α-helix	72-75	4
α-helix	78-80	3
α-helix	89-92	4
α-helix	97-100	4
α-helix	107-115	9
α-helix	122-139	18
α-helix	141	1
α-helix	145-161	17

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	61-65	5
α-helix	66-71	6
α-helix	72-75	4
α-helix	81-83	3
α-helix	96-98	3
α-helix	107-115	9
α-helix	122-138	17
α-helix	145-161	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 4	A, B	protein	140	Homo sapiens	O60885 (AlphaFold model)
Envelope small membrane protein	C	protein	9	Severe acute respiratory syndrome coronavirus 2	P0DTC4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7TUQ_1 Bromodomain-containing protein 4 (chains A, B)
GSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKI
IKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQK
INELPTEETEIMIVQAKGRG

Sequence of entity 2 (C), FASTA

>7TUQ_2 Envelope small membrane protein (chains C)
SRVKNLNSS

Primary citation

Binding of the SARS-CoV-2 envelope E protein to human BRD4 is essential for infection. Vann, K.R., Acharya, A., Jang, S.M. et al. Structure (2022) 30:1224. DOI 10.1016/j.str.2022.05.020 · PubMed

Other PDB entries of the same protein (UniProt O60885 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4QB3 0.94 Å, Crystal structure of the first bromodomain of human BRD4 in complex with Olinone
6FO5 0.95 Å, First domain of human bromodomain BRD4 in complex with inhibitor #17
7Z9W 0.99 Å, BRD4 in complex with FragLite1
4ZC9 0.99 Å, Crystal Structure of the BRD4a/DB-2-190 complex
9P34 0.99 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
6I7Y 1.0 Å, Crystal Structure of the first bromodomain of BRD4 in complex with RT56
7ZAJ 1.0 Å, BRD4 in complex with FragLite16
8YMG 1.01 Å, BRD4-BD1 in complex with 7-[4-chloro-1-(tetrahydropyran-4-ylmethyl)imidazol-2-yl]-5-methy…
8YMI 1.01 Å, BRD4-BD1 in complex with 2-{[(3S)-1-benzylpyrrolidin-3-yl]methyl}-5-methyl-7-(1-methylpyr…
9P33 1.01 Å, Crystal structure of the Bromo domain 1 in human Bromodomain Containing Protein 4 with a…
8YMF 1.01 Å, BRD4-BD1 in complex with 7-[2-(cyclopropylmethoxy)phenyl]-5-methyl-2-[(1-methylsulfonyl-4…
7Z9Y 1.04 Å, BRD4 in complex with FragLite2

Browse structure collections

About this viewer

MolViewer shows 7TUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.